KEGG   Paenibacillus mucilaginosus KNP414: KNP414_03939Help
Entry
KNP414_03939      CDS       T01550                                 

Definition
(GenBank) Glucan 14-alpha-maltohexaosidase
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
pms  Paenibacillus mucilaginosus KNP414
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pms00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    KNP414_03939
Enzymes [BR:pms01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     KNP414_03939
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
4087669..4089225
Genome map
AA seq 518 aa AA seqDB search
MSRIWSRRKTAKVIVSAALAFTLIASPGTEKAHAHHDGSNGVMMQYFEWYLPNDGTLWSK
LQTNAAALKSAGVTAVWIPPAYKGGGSGDVGYGVYDMYDLGEFNQKGTVRTKYGTKDQLV
SAVDTLHANGMQVYGDVVLNHRMNADATETVTAVEVNPSDRNSEISGEYSISAWTQFYFP
GRNNAYSSFKWKWYHFDGVDYDQSRNANKLFKLRGTGKSFDWEVDTENGNYDYLMGADLD
WDHPEVISETRTWGNWFVNTAKLDGVRIDAVKHIKFDRMRDWLNGVRTDTGKSLFAVGEY
WSGDINKLNNYMTKTSGAMSLFDVPLHYNLYAASNGSGGYDMRNILNNTLLKTNPTKAVT
FVDNHDSQPGQALQSTVQGWFKPLAYALILTRQEGYPSLFYGDYYGTSDGKIASYKTVLD
KLLAARKTYAYGKQNDYLDHQDIIGWTREGDAAHTNSGLAALVTDGPGGSKRMYVGTGKA
GQVWNDKTGNRTDTVTIDGSGYGTFPVNGGSVSVWAKQ
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgtcccggatttggtcccggcgtaaaaccgcaaaagttattgtaagcgctgccttggcc
ttcaccctgatcgcctcccccggcacagaaaaagcccatgcccaccatgacggcagcaac
ggtgtcatgatgcagtatttcgaatggtatctcccaaatgacgggaccctgtggagcaag
ctgcagacgaatgcggccgccctgaagagcgccggcgtgacggccgtctggatcccgcct
gcatacaagggcggaggcagcggcgacgtcgggtacggggtctacgacatgtacgacctc
ggcgagttcaaccagaaaggcactgtgcgtaccaagtacggcacgaaggatcagctggtc
agcgccgtggataccctgcacgcgaacggcatgcaggtgtacggggatgtcgtgctcaac
caccggatgaacgccgacgccaccgagacggtcacagcggtggaagtgaacccgtccgac
cgcaacagcgaaatctcgggggaatactccatctcggcatggacgcagttctattttccg
gggcgtaataatgcgtactcctccttcaagtggaaatggtatcacttcgacggcgtggac
tacgatcaatcacggaatgcgaacaagctcttcaagctccgcggcaccggcaaaagcttc
gactgggaggtcgatacggagaacggcaactacgactacctgatgggcgcggacctcgat
tgggatcatccggaagtcatcagcgaaacgcgcacctgggggaattggttcgtcaacacg
gcaaagctcgacggcgtccgcatcgatgccgtaaagcacatcaaattcgaccggatgcgc
gactggctgaacggcgtgcggaccgatacggggaagagcctgttcgcggtaggagaatac
tggagcggggatattaacaagctgaacaattatatgaccaaaacgagcggtgccatgtcc
ctcttcgacgttccgctgcattataacctgtacgcggcttcgaacggcagcggcggctat
gacatgcggaacattctgaataacacgctgctcaagaccaatccgacgaaagccgtcacc
ttcgtggacaaccatgactcccagccgggccaggcgctccaatccaccgttcagggctgg
ttcaagccgctcgcctacgccctgatcctcacccgccaggaaggatatccgtccttgttc
tacggcgattactacggcacgtcggacggtaagatcgcttcgtataaaaccgttctggac
aagctgctcgcagcgagaaaaacgtatgcctacggcaagcagaacgactatctcgaccac
caggacatcatcggctggacccgtgagggagatgccgcccatacgaactccggcttggcc
gcgctcgtgaccgacggaccgggaggcagcaagcggatgtatgtaggcacagggaaggcc
ggccaggtgtggaacgacaagaccggcaaccggacggataccgtgacgatcgacggcagc
ggctacggcacattcccggtcaacggcggctccgtatccgtatgggcgaagcagtag

DBGET integrated database retrieval system