KEGG   Paenibacillus mucilaginosus KNP414: KNP414_07524Help
Entry
KNP414_07524      CDS       T01550                                 

Gene name
tuf
Definition
(GenBank) Tuf
  KO
K02358  elongation factor Tu
Organism
pms  Paenibacillus mucilaginosus KNP414
Brite
Translation factors [BR:pms03012]
 Eukaryotic Type
  Elongation factors
   KNP414_07524 (tuf)
 Prokaryotic Type
   KNP414_07524 (tuf)
Mitochondrial biogenesis [BR:pms03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    KNP414_07524 (tuf)
Exosome [BR:pms04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   KNP414_07524 (tuf)
  Exosomal proteins of breast cancer cells
   KNP414_07524 (tuf)
  Exosomal proteins of colorectal cancer cells
   KNP414_07524 (tuf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: AEI46018
UniProt: F8FA45
LinkDB All DBs
Position
complement(8219269..8220459)
Genome map
AA seq 396 aa AA seqDB search
MAKAKFERNKPHVNIGTIGHVDHGKTTLTAAITTVLSKKYGGAAVAFDQIDKAPEERERG
ITISTAHVEYETPNRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLSRQVGVPYIVVFLNKCDMVEDEELLELVEMEVRDLLNEYEFPGDDTPIIRGAAREALQ
NPDGPWAEKIVELFEQIDTYIPTPERDTDKPFLMPVEDVFTITGRGTVATGRVERGVIKV
GDEIEIIGLAEETRKSVVTGVEMFRKLLDSAQAGDNIGALLRGVDRKDIERGQVLAKPGS
VKPHTNFSAQIYVLTKEEGGRHKPFFTGYRPQFYFRTTDVTGIINLPEGSEMVMPGDNIT
VTVELISPIAIEEGTRFAIREGGRTVGAGAVASISK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagcgaaatttgaacgtaataagccgcacgttaacattggtactatcggtcac
gtcgaccacggtaaaactaccctgacggctgcaatcacaactgttctgtccaagaaatac
ggcggtgcagctgtagcattcgaccaaatcgacaaagcaccagaagagcgcgagcgtggt
atcacaatctccactgcacacgttgaatacgaaacacctaaccgtcactacgcacacgtt
gactgcccaggccacgccgactatgttaaaaacatgatcaccggcgcagcacaaatggat
ggcgcgatcctcgtagtatccgcagctgacggccctatgccacaaactcgtgagcacatc
ctgctctcccgtcaagtaggcgtaccatacatcgttgtattcctcaacaagtgtgatatg
gttgaagacgaagagctcctcgagctcgttgaaatggaagttcgcgacctgctgaacgag
tatgagttcccaggcgacgacactccaatcatccgtggtgcagctcgtgaagcgctgcaa
aacccagatggtccttgggctgagaagatcgttgaactgttcgaacagatcgacacttac
atcccaactccagagcgcgacacggacaagcctttccttatgcctgtcgaggacgtattc
acgatcactggtcgtggtaccgttgctacaggtcgtgtagagcgtggcgttatcaaagtc
ggcgacgagatcgaaatcatcggtctggctgaagaaactcgcaagtccgttgttacaggc
gttgagatgttccgtaagcttctggactccgctcaagccggcgacaacatcggcgcactg
cttcgtggtgtagaccgtaaggacatcgagcgtggtcaagttctggcgaagccgggttcg
gttaagcctcacacgaacttttccgcacaaatctacgtcctgactaaagaagaaggtggc
cgtcacaagcctttcttcactggctaccgtccacagttctacttccgcacaacggacgta
acaggcatcatcaacctgcctgaaggttccgagatggttatgccaggcgacaacatcact
gtaacggttgagctgatctccccgatcgctatcgaggaaggcactcgcttcgctatccgc
gaaggcggccgtacagttggtgcaggcgcggttgcttccatcagcaagtaa

DBGET integrated database retrieval system