KEGG   Prunus mume (Japanese apricot): 103318531Help
Entry
103318531         CDS       T03196                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn]
  KO
K04565  
superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
pmum  Prunus mume (Japanese apricot)
Pathway
Peroxisome
Brite
KEGG Orthology (KO) [BR:pmum00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    103318531
Enzymes [BR:pmum01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     103318531
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
LG1
AA seq 152 aa AA seqDB search
MVKGVAVLGSSEGVKGTINFTQEGDGPTTVTGSISGLKPGLHGFHVHEFGDTTNGCLSTG
PHFNPDAKHHGSPEDEIRHAGDLGNITVGDDGTANFTIIDKQIPLTGPQSIIGRAIVVHA
DPDDLGKGGHELSKSTGNAGGRVACGIIGLQN
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggtgaagggtgttgctgttcttggctccagtgagggtgttaaaggaaccatcaacttc
acccaggagggagatggcccaactactgtgactggaagtatttctggcctcaagcctggg
cttcatggtttccatgtccatgaatttggagacacaaccaacggttgcttgtcaactgga
ccgcatttcaatcctgatgccaagcaccatggttcccctgaagacgagattcgccatgcc
ggtgatcttggaaatatcactgttggggacgatggaactgcaaacttcacaattattgac
aagcagattcctctcactggaccacaatcaatcattggtagggcgattgttgtccatgct
gaccccgatgacctgggcaagggtggacatgagcttagcaaaagcactggaaatgctggt
ggcagggttgcttgtggtattattggtctccaaaactga

DBGET integrated database retrieval system