KEGG   Prunus mume (Japanese apricot): 103319764Help
Entry
103319764         CDS       T03196                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: histone-lysine N-methyltransferase ASHH2
Organism
pmum  Prunus mume (Japanese apricot)
SSDB OrthologParalogGFIT
Motif
Pfam: SET zf-CW
Motif
Other DBs
NCBI-GeneID: 103319764
NCBI-ProteinID: XP_008219574
LinkDB All DBs
Position
LG2
AA seq 2105 aa AA seqDB search
MASCENSAFVDGLLCESVTEQQMGSEILVQSISELPSCSDDKSLLDSNVDPISISDRSLG
LSRNDNADAGCMSWVEIVDVDIDGLMGEHENANVSEPGNILTREWGLNRCCLTENQSNVD
DSNREGGPQGEDRSAGSFGDCEIPLEVIPQTVSPGHGIQQDEQRYDNYLFSEGVREVTEE
MKNDIHELVSPLQGCEIPSELADMEACGSSQQEEKGFNIISGSSFETACEESVVLARIEA
DLCKRTSPKRDGGMPSEVSYACDLVSNCVWKNEEMEDNGVSGLNSLSTERTTEVVETRCN
QILPSQGFTQQNDQRSDKVNGGSFVERATEYLEETSDALPDERALIHTQILPVKANVYYS
KEGSSKVAPDCVIENSVSMQSCQTFGIANNSVNGPSADSVTEVVEMESHIDAHNQIVPPE
GCQRAFEGSHVSDSPSVCTQENGESNGKIIGFLTAKRVTEFEEQKSDATTDIKVEIGAQI
LLLEEKASNLKEGSSELAPKSIHEKSVSMQSFQPFDIVNSGSSEKLDVPDKDSPAHVDSS
TSFDRYGEMDHEGNDNVRVDCVSNTKCVALSSRRSGRSRKTQTKRAPRKGRNTSKVLDPL
GSVEIVFKAAGRKRSCLSKPARSSIWGLLGNVTQSFEESNRLEVSQGLIQGGSQKGRGGQ
RSGKRNPSGASGNSRGSRGKCRASTNHVRLKVKLGKEMGKSSFYIRVPEVVDNTAYENSV
EKENGIEGNWNKEATLREDKTCPDAPLLDGDLANKDLESVVLTENSAEDVIENFPGGSSH
TIAVSSGGSVGTNYRDPGTSPDSEVTNLVPDADVEARPLEDSNGIVLTSDKAFSASGDFI
STKRGKKKHKVPHAENCVREDGIPCPASINKEKPSKQDGRRQNVSQDFCPSETFTSSTCA
NASSNSSSDMESSLEPLRLSGETDHGISRDVLEVEIGAEAKTHCNLDVGLGLSKSQSSKT
KGLKPPKGRSRGCGSASKKGNYHRLRENQKKSVNQKNAMEKAVGDQVAFKVESLPESDDH
LVDEIRKSNSVKDAVCIGVPNSDTVPVDLDKQYAPLRNAWVLCDDCHKWRRIPAELADVI
DEIKCTWTCRDNKDKAFADCSIPQEKSNSEINAELDISDASGDEDASVTRLNYKELERRR
PTVSQQNVASIKTNQFLHRNRKTQTIDEIMVCHCKPPSDGQLGCGDDCLNRMLNIECIRG
ACPCRDLCSNQQFQKRRYAKLEKFRCGKKGYGLRLLDDIFKGQFLIEYVGEVLDTHAYEA
RQKEYALKAHRHFYFMTLNGSEVIDACAKGNLGRFINHSCDPNCRTEKWMVNGEICIGLF
ALRDIKKGEEVTFDYNYVRVFGAAAKKCYCGSAQCRGYIGGDPLDSEVIIQDDSDEEYIE
PVMIPEDGISEKVESASTNKEMDKSTIAVGELEFTTQREEFVNPSEYAVSHIHDSLELEH
SRQKLPSSVQPVEEILRENETKEKSSSSFERLEIASPIKVLSKSLSDGIDANRKSKSDTT
EDRQVSSKVRPNVKTSRSSSFVKKGKVRIIPSGNKIQVAANKSHVLSIKPKRLTEGSVEE
KLNELLDVDGGINKRKDSTKGYLKLLFLTAVSGDSGNGEAIQSNRDLSMILDALLKTRSR
VVLIDVINKNGLRMLHNIMKKYREDFKKIPILRKLLKVLEYLAVKQILTLEHITGGPPCP
GMESFMESMLSLTEHKDKQVHQIARNFRDRWIPRHLRRHGFVDRDDSKMEFNRGSNCNRL
STSHDNWRDQSGRSTDTIDSIKQSVLSTTSVSTGVQDCSAPCTGGCPTSVTKVRKRKSRW
DQPAETIPDSSSLQNKEQKTESGLHRPSPLSGTGEVALHLERVSGDDGNCSSSVHDYSQQ
NDGAQINLEDVPPGFSSYIRTPMVSSIASSSFCPLKCPAAVIGHPQEKFVSRLSVSYGFP
LSMMRQYGTPHAETVGTWAVAPGIPFQPFPPLPPFPRHKKDPSPYPTVNHVSGNQPAGGQ
PDWCVPATSQSEESTPSTTGSNLADFGSPCANNQYSSKRVRESSNDLGRRYFKQQKYWNN
TKLRTPSFSDRNGWGCTGNNSGCGTADGIGVGHVANELSTSYCSEDLSYRVEKAGNNVNQ
HSHHH
NT seq 6318 nt NT seq  +upstreamnt  +downstreamnt
atggcttcttgtgaaaattcggcttttgttgacggtcttttgtgtgagtctgttacagag
cagcagatgggctcagagattttggtgcaatctatttctgagctgccctcctgctcggac
gataagtctttacttgattctaatgtggaccctatcagtatatcagataggtctctggga
ttgtctaggaatgacaatgctgatgctggttgtatgagctgggttgagattgtagatgtt
gatatagatggtttgatgggtgagcatgaaaatgctaatgtttcggaaccgggaaatatt
ttgaccagggaatgggggctgaacagatgttgcttgactgaaaatcagagtaatgttgat
gactcaaatagggaaggtgggccccaaggtgaggatagatctgctggttcatttggggac
tgtgaaatccctttggaagtcatacctcagactgtttcaccaggacatggtatccaacag
gatgagcaaaggtatgataattatctgttttctgaaggggttagggaagttacggaagag
atgaagaatgatatccatgaactagtctctcctttacagggttgtgaaattccctcagaa
ttagctgacatggaagcttgtggaagctcccaacaagaagagaagggtttcaacatcata
tctggttcctcttttgaaactgcttgtgaggaaagtgttgttttggccaggatagaagca
gatttgtgcaagaggacatcacctaaacgggatggtggaatgccttcggaagtatcatat
gcatgtgatttagtaagtaattgtgtctggaagaatgaagagatggaggacaatggtgtt
agtggtctgaatagtctctctacagaaaggactacagaggttgttgagacgaggtgcaac
caaatattgccttcacaaggtttcactcaacagaatgatcagaggagtgataaggttaat
ggcggttcctttgttgaaagggctacagagtatttggaagagacaagtgatgctctgcca
gatgaaagggctttaattcacacccagatattacctgtaaaagctaatgtttactattct
aaggaaggttcttccaaagtagcccctgactgcgttattgagaactctgtttccatgcag
tcatgtcaaacctttgggattgccaataacagtgtcaatgggccctctgctgatagtgtt
acagaggttgttgagatggaaagccatattgatgcgcacaatcaaatagtgcctccagag
ggttgccagagggcctttgaaggttcacacgtgtcagattcaccaagtgtttgcacccaa
gagaatggcgagagcaatggtaagattattggttttctcactgccaaaagggtaacagag
tttgaagaacagaaaagtgatgctacaaccgacataaaggttgaaattggtgcccagata
ttactactggaggaaaaagcctccaatctgaaggaaggttcttctgaactagcccccaaa
agtattcatgagaaatctgtttctatgcaatcgtttcaaccttttgatatcgtcaacagt
ggttcttctgagaagctggatgtaccagataaggattctcctgctcatgttgattctagc
acttcatttgaccgttatggagagatggatcatgaaggaaatgataatgtcagagttgat
tgtgtttctaacaccaaatgtgttgcattgtcttctcgaaggagcggccgaagccgcaag
actcagacaaaaagggctccaaggaaaggcaggaacacatctaaagtgttagacccgctt
ggaagtgttgaaattgtcttcaaggctgctggaaggaagaggagctgcctttccaaacca
gctcgttcttctatctggggattattagggaatgttacacaatcttttgaagagagtaac
aggcttgaggtcagtcaaggtctgattcaaggaggatcacagaaaggaaggggtggccaa
agaagtggaaaacggaatccaagtggggctagtggaaactcacgagggtcaagggggaaa
tgccgtgcttcaactaatcatgttcgtttgaaggttaaattggggaaagaaatgggtaaa
agttctttctatatcagagtacctgaggttgttgataacacagcatatgaaaattctgtt
gaaaaagagaatggcattgagggtaattggaataaagaagccactcttagggaggataaa
acttgtccagatgctcctcttctggatggagatctggctaataaggacttggagagtgtt
gttcttacagagaattcagctgaagatgtgatagagaattttcctgggggttcatctcat
acaattgctgtatcatcaggaggatctgttgggactaactatagagatcctggaacttca
cctgattcagaagtaaccaatttagttccggatgcagatgttgaggcaagaccactggaa
gattctaatggtattgttttgacttctgacaaggctttttctgcttctggagactttatt
agcactaagagaggaaagaagaaacataaagtacctcatgcggaaaattgtgttcgggaa
gatggtataccgtgtccagcaagcataaataaagaaaaaccatcaaaacaagatggacgc
agacagaatgttagtcaggatttttgccctagtgagacattcacttcatccacctgtgca
aatgcttcaagtaattcatcaagcgacatggaatcatctttggagcccttgcgtttgtca
ggagaaactgatcatggaatttctagagatgttctcgaagttgaaattggtgcagaagct
aaaacacattgcaatctagatgtaggcttagggttatcaaaatcacaatcctcaaaaact
aagggactgaagcctccgaagggcaggtccagaggctgtggctcagcgagcaagaaaggt
aattatcatagactgagggaaaaccaaaagaagtctgttaatcagaagaacgctatggag
aaggctgttggcgatcaggttgccttcaaagtggaaagtcttccagaatcagatgatcac
ttagtggatgaaattagaaaatccaactctgtcaaggatgctgtatgcataggtgttcct
aactcggacactgtacctgttgacttagataagcagtatgcaccgctgcgtaatgcttgg
gtgctctgtgatgattgtcataaatggaggcgtataccagctgagcttgcagatgttata
gatgaaataaagtgcacatggacctgtagagataacaaggataaagcctttgctgattgc
tcaatccctcaagagaagtcaaattcagagattaatgcagagttggatatatcagatgcg
tcaggtgacgaagatgcttccgtcacccgattaaattataaagaattggaacgtcggcgc
ccaacagtttcccaacagaatgttgcaagcatcaaaactaatcagttccttcatcgtaac
cgtaaaactcagactattgacgagataatggtttgccattgcaaaccaccttcagatggc
cagttgggttgtggagatgattgccttaatcgaatgcttaacattgagtgtattcgagga
gcctgtccttgtagagacctttgttcaaatcaacagttccaaaaacgccgatatgccaaa
ctggagaagtttcgatgtgggaagaagggttatgggctcaggttgcttgatgatatattt
aaagggcaatttctcattgaatatgttggagaggtgcttgatacacatgcttatgaggca
cggcaaaaagagtatgctttaaaggctcacagacatttctacttcatgacattgaatggc
agtgaggtaattgatgcatgtgcaaagggaaatttggggcgtttcattaaccatagttgt
gatcctaattgtcgcacagaaaagtggatggtgaatggagagatttgcataggactattt
gcattgagagatataaagaagggcgaagaggtgacatttgactacaactatgtaagggtt
tttggagctgctgccaaaaaatgttattgtggctcagctcaatgtcggggttatataggt
ggtgatcctcttgatagtgaagtcatcattcaagatgattcagatgaagaatatattgag
cccgtgatgattccagaagatggtatatctgaaaaggtggagagtgcatctacaaataaa
gaaatggataagtcaacaattgctgttggggaattggagtttaccacacaaagggaggag
ttcgtgaacccatctgaatatgctgtttcgcatatacatgattcactggaactggagcac
tcaagacaaaaattaccatcttctgtccaaccagttgaagagattttaagggaaaatgag
actaaagaaaaatcctcaagctcatttgaaagactagagattgcttctccaataaaagtt
cttagcaagtctttatctgatggcattgatgctaacaggaagtccaagtctgacaccact
gaagataggcaggtttcttctaaagtgcgtcctaatgtgaaaacttcccgttcatccagt
tttgtgaagaaaggcaaagtgaggattatcccaagtggtaacaaaattcaagtggcggcc
aacaaatctcatgtgctttctatcaaacccaaaagattaacagaaggttcagtggaggag
aagcttaatgagctgttggatgtcgatggagggataaataaacggaaagattccactaaa
ggctacttgaagcttctgttcctaactgcagtatcaggtgatagtggcaatggtgaagca
attcagagcaatcgagatctttcgatgatccttgatgcgcttttgaaaacaaggtcacgg
gtggttttgattgatgtaataaataaaaatggtttgagaatgctacacaacataatgaag
aagtacagagaagacttcaaaaagataccaatcctccggaagcttctgaaggtcctagaa
tatttggctgtaaagcagatacttacgttggaacatattactggaggtcctccttgccct
ggaatggagagctttatggagtcaatgctatcattgacagaacacaaggacaaacaggtc
caccaaatagcacggaactttcgagataggtggatccctagacatctcagaagacatggc
tttgtagacagggatgatagcaagatggaatttaacaggggttcaaactgcaacagatta
tccacatcacatgataattggcgtgatcaaagtggaaggtctactgacactatagatagt
atcaagcaatcagtgctttcaacgacttctgtgagtacaggtgtccaggactgttctgca
ccttgtacaggtggatgcccaaccagtgtgacaaaagttcgcaagcgtaaaagccgatgg
gatcagccagcagagacaatccctgattcaagttcactgcagaacaaagaacagaagacc
gagtctggattgcatagacctagtccattgtctgggacaggtgaagtggcattgcattta
gagagggtgagtggcgacgacggaaattgctcaagcagtgtgcatgattactctcagcaa
aatgatggagctcagatcaaccttgaggatgttcctcctgggttttcatcttacattaga
acccctatggtttcatctattgcttcgtcatcattttgtcctttgaagtgtcctgctgca
gttatagggcatccacaagagaaatttgtttctcgcttatctgtctcgtatggatttcca
ctgtcaatgatgcggcagtatgggacaccacatgctgaaactgtagggacttgggctgtt
gcacctggcataccttttcagccttttccaccattgcccccctttccccgacataagaaa
gacccttcaccttatcctaccgtcaatcatgtatcaggtaatcaacctgcaggaggacaa
ccggactggtgtgttcctgcaacttctcagtctgaagaaagcactccaagcacaactggt
tccaatctggcagactttggcagtccatgtgcaaacaatcaatattcatctaaacgagtt
agagaatcctcgaatgatttgggaaggagatacttcaagcagcagaagtactggaataat
acaaaattgaggaccccatctttcagtgaccgaaacgggtggggatgtactggaaacaac
tccggatgtggtacagcagatggcataggcgtaggacatgtagcaaatgagcttagtact
tcatattgttcagaggatttaagctatagggtggagaaagctgggaataatgtcaatcag
cattcacatcaccattaa

DBGET integrated database retrieval system