KEGG   Prunus mume (Japanese apricot): 103326162Help
Entry
103326162         CDS       T03196                                 

Definition
(RefSeq) DNA ligase 1-like
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
pmum  Prunus mume (Japanese apricot)
Pathway
pmum03030  DNA replication
pmum03410  Base excision repair
pmum03420  Nucleotide excision repair
pmum03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:pmum00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    103326162
   03410 Base excision repair
    103326162
   03420 Nucleotide excision repair
    103326162
   03430 Mismatch repair
    103326162
Enzymes [BR:pmum01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     103326162
    6.5.1.6  DNA ligase (ATP or NAD+)
     103326162
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     103326162
DNA replication proteins [BR:pmum03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    103326162
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     103326162
DNA repair and recombination proteins [BR:pmum03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     103326162
   NER (nucleotide excision repair)
    Other NER factors
     103326162
   MMR (mismatch exicision repair)
    Other MMR factors
     103326162
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-GeneID: 103326162
NCBI-ProteinID: XP_008226585
LinkDB All DBs
Position
LG1
AA seq 789 aa AA seqDB search
MLSRSLCSCYCLRPRSLHHLTTSISLFRSKPSSLSLTLISLSPKNPNLRAMSSRPSAFDA
LMSGARAAAAKKKPQASPSKKRKTLEPNPIENPQLLLKPENGSPTQAPESKEVKEALESS
SNGGQVVPPAKKVCSAAGAQERTAELKSRIALLKKKAGDFDPKLMANWGEGERVPFAFVC
LAFDLIANETGRIAITDIVCNLLRTVMHTTPEDLVPVVYLAANRIAPAHEGLELGIGDAS
IIKALAEACGRTEAHVKKQYKELGDLGLVAKASRSSQSMMRKPDSLTVTKVFSTFRQLAK
ESGKDSQEKKKNHIKALLVAATDCEPQYLIRLLQTKLRIGLAEQTLLAALGQAAVHAEKH
STPPSHIQSPIEEAAKIVKQVYSLLPDYDKIIPALLSGGVWNLPKTCSFTLGVPVGPMLA
KPTKGVSEIVQKFQDTEYTCEYKYDGERAQIHYMEDGSVEIYSRNAERNTGKFPDVVVAV
SRLKKSSVTSFVLDCELVAYDREKQKILPFQVLSTRARKNVAMSDIKVDVCIFAFDMLYL
NGQPLIQEQLKVRRESLYDSFVEEAGFFQFATAITSNDIEEIQKFLDAAVDSSSEGLIIK
TLNKDATYEPSKRSLNWLKLKKDYMESIGDSLDLVPIAAFHGRGKRTGVYGAFLLACYDS
NNEEFQSICKIGTGFSEAMLEERSASLRTKVIPKPKSYYRYAETMNPDVWFDASEVWEVK
AADLTISPVHRAAVGIVDPNKGISLRFPRLVRVREDKPPEQASSSAQVAEMYSAQANTRS
NNQDDNEDD
NT seq 2370 nt NT seq  +upstreamnt  +downstreamnt
atgctctcccgatcattgtgttcatgctattgtctacgcccacgctctctccaccatctc
accacctccatttctctcttccgctccaaaccctcttctctctctctcaccctcatttcc
ctctccccgaaaaaccctaatcttcgcgccatgtcctctcgcccctccgccttcgacgct
ctcatgtccggcgctcgggccgccgccgccaagaaaaagccccaagcttcaccctccaag
aagcgaaaaaccctagaacctaaccctattgaaaacccccaattgctattgaaacccgaa
aatggcagtccaacccaagccccagaatccaaagaagtcaaagaagctctagaaagttct
agtaatggcggccaggtggttccccccgcgaaaaaagtgtgctcggcggcaggtgctcag
gagcggacggcggaattgaagagccgaatcgctctgttgaagaagaaagccggtgacttt
gacccgaaattgatggcgaattggggcgagggcgagagggttccgtttgcgtttgtttgt
ttggcttttgatttgattgctaacgagacgggtcggattgcaatcacggatatagtgtgt
aacctgttgaggactgtaatgcacaccacgcctgaggatttggtgcccgtggtttatctg
gcagcaaatcggattgcgccggcacatgagggattggagcttggaattggggatgcttcg
attatcaaggcgcttgcagaggcttgtgggaggactgaagcacatgttaagaaacaatac
aaggaattgggagatttgggtcttgttgcaaaagcaagccgttcatctcaatctatgatg
cgcaagcctgattcgttaactgtgaccaaggttttcagtacatttcgtcaacttgctaag
gaatctgggaaggatagtcaggagaagaaaaagaaccatatcaaggcacttcttgttgct
gccactgattgtgaacctcaatatctgatccgtttgcttcagacaaagttgcgaattggg
ttggcagagcagactctcttagctgcattgggacaagctgcagtgcatgctgaaaaacat
tctacaccaccttctcatattcagagtcctatagaagaggctgcaaagattgttaagcaa
gtgtactctctacttcctgattacgataaaatcatccctgcccttttaagtggtggtgtg
tggaatcttccgaagacatgtagctttactttgggtgtcccagttggacctatgctagca
aagccaactaaaggtgtatctgagattgtacagaagtttcaggatacagaatacacctgt
gaatacaagtatgatggagaacgcgcccagatacattacatggaggatggttctgttgag
atatacagtcgaaatgctgaacgaaacactggaaagttccctgatgttgttgttgcagtg
tcgaggttaaagaagtcatctgtaacgtcatttgttttggattgtgaattggttgcttat
gaccgtgaaaaacagaaaattcttcctttccaggtactcagcactagagctcgtaaaaat
gtggccatgagtgatattaaggtcgatgtctgcatatttgcttttgacatgttgtatctt
aatggacaaccactaattcaggaacaactgaaagttcgtagagagagtctttatgactct
tttgtggaagaagctggattttttcagtttgccacagcaataacatcaaatgatattgaa
gaaatacaaaagtttcttgatgctgcagttgattcaagttctgagggtttaattatcaaa
acattgaacaaagatgctacttacgagccttcaaagcggtcacttaactggctgaaattg
aagaaagattatatggagagtattggggactcactagacttggtgcctattgctgctttc
catggccgggggaaacgtacaggtgtctatggtgctttcctccttgcttgttatgatagc
aacaatgaagagtttcaaagcatttgtaaaataggcactggattctctgaagcaatgctt
gaagaacgttctgccagtctccgtactaaagtgatacccaaacctaagtcatactatcgt
tatgcagaaacaatgaatcccgatgtatggtttgatgcctctgaggtttgggaagtgaaa
gctgcagacttgactattagccctgttcatcgcgccgcagttggcatagtggatcctaat
aagggtatttctcttcgatttccacgtcttgttcgtgttcgggaggataaacctccagag
caagcctcatcatctgcgcaggttgctgagatgtattctgctcaagctaacactcgttcg
aacaatcaagatgacaacgaagatgattaa

DBGET integrated database retrieval system