KEGG   Prunus mume (Japanese apricot): 103327380Help
Entry
103327380         CDS       T03196                                 

Definition
(RefSeq) glutamate decarboxylase 1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
pmum  Prunus mume (Japanese apricot)
Pathway
pmum00250  Alanine, aspartate and glutamate metabolism
pmum00410  beta-Alanine metabolism
pmum00430  Taurine and hypotaurine metabolism
pmum00650  Butanoate metabolism
pmum01100  Metabolic pathways
pmum01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pmum00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    103327380
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    103327380
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    103327380
   00430 Taurine and hypotaurine metabolism
    103327380
Enzymes [BR:pmum01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     103327380
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 103327380
NCBI-ProteinID: XP_008227916
LinkDB All DBs
Position
LG4
AA seq 503 aa AA seqDB search
MVLSKTASESDVSVHSTFASRYVRNSLPRFKMAENSIPKEAAYQIINDELMLDGNPRLNL
ASFVTTWMEPECDKLMMASINKNYVDMDEYPVTTELQNRCVNIIAHLFNAPLGESESAVG
VGTVGSSEAIMLAGLAFKRKWQNKRRAEGKPIDNPNIVTGANVQVCWEKFARYFEVELKE
VKLREGYYVMDPEKAVEMVDENTICVAAILGSTLNGEFEDVKRLNDLLVEKNKETGWDTP
IHVDAASGGFIAPFLYPELEWDFRLPLVKSINVSGHKYGLVYAGIGWVIWRNKEDLPEEL
IFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGFEGYRNVMENCRENMIVLKEGLEK
TKRFNIVSKDEGVPLVAFSLRDNHRHDEFEISDLLRRFGWIVPAYTMPPDAQHVTVLRVV
IREDFSHTLAERLVNDIQKVLHELDTLPSKLSSNVKAADGEDGKPAETRALESKKSDLEK
TREITTIWRKFVMARKQKMNVVC
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggttctctcaaagactgcttcggagtcggatgtctccgtccactcaaccttcgcttct
cgatatgttcgaaattctctccccagattcaaaatggcggaaaactcgatccccaaggag
gcagcgtaccagatcataaacgacgagcttatgttggacggcaacccgaggctgaatctg
gcgtcattcgtgaccacatggatggagcctgagtgcgataaactgatgatggcctccatc
aacaagaactatgtggacatggatgaataccctgtcaccactgagctccagaatcggtgc
gtaaacatcatagctcatctattcaatgccccattgggggagtcagagtcagcagttggg
gtgggaactgtgggctcttctgaagccatcatgttggccggcttagctttcaagaggaag
tggcagaacaagaggagagctgagggcaagcccattgacaaccccaacattgtcaccgga
gccaatgtccaggtgtgctgggagaaatttgcaaggtactttgaggtggagttgaaggag
gtgaagttgagggaaggatactatgtaatggaccctgagaaggcagtggagatggttgat
gagaacaccatctgcgtcgctgctatcctcggctccactctcaatggagaattcgaagat
gttaagcgcctgaatgatctcttggtagagaagaacaaggaaactggatgggatactcca
atccatgtagacgcagcaagtggtgggtttattgcaccatttttgtacccagaacttgag
tgggacttccgtttgcccttagtgaagagcatcaatgttagtgggcacaagtacggactt
gtgtatgcaggaattgggtgggtcatctggaggaacaaagaggacttgcctgaggaactc
atcttccatatcaactatctcggagcagatcaacctaccttcaccctcaacttctcaaaa
ggttccagccaagttattgctcaatattatcaactgattcgcttgggttttgagggatac
aggaatgtcatggaaaattgtcgtgaaaacatgatagtactaaaagaaggattggagaag
acaaagcgcttcaacatagtctctaaagatgaaggggtaccattggtggccttttctttg
agggacaaccaccgccacgacgagttcgaaatctctgacttgctccgccgctttggatgg
attgtccctgcctacaccatgcccccagatgcacaacatgtgacagttttgcgcgttgtg
attagagaagacttctctcacactttggcggagcgcctagtgaatgatatccagaaagtg
ttgcatgaactagacacacttccatctaagcttagctccaatgtgaaggctgccgacgga
gaggatgggaaacctgcagagacgagggcacttgagagtaagaagagtgatttggaaaag
acaagggagatcacaacaatttggaggaagtttgttatggccaggaagcagaagatgaat
gttgtttgttag

DBGET integrated database retrieval system