Prunus mume (Japanese apricot): 103331274 Help Entry 103331274         CDS       T03196                                  Name (RefSeq) SKP1-like protein 1A   KO K03094   S-phase kinase-associated protein 1 Organism pmum  Prunus mume (Japanese apricot) Pathway pmum03083   Polycomb repressive complex pmum04120   Ubiquitin mediated proteolysis pmum04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:pmum00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     103331274    04120 Ubiquitin mediated proteolysis     103331274   09126 Chromosome    03083 Polycomb repressive complex     103331274  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pmum04131]     103331274    04121 Ubiquitin system [BR:pmum04121]     103331274    03036 Chromosome and associated proteins [BR:pmum03036]     103331274 Membrane trafficking [BR:pmum04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     103331274 Ubiquitin system [BR:pmum04121]  Ubiquitin ligases (E3)   Multi subunit Ring-finger type E3    SCF complex     Adaptor protein      103331274    Cul7 complex      103331274 Chromosome and associated proteins [BR:pmum03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      103331274   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      103331274 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ Skp1 T4_Rnl1_C Flu_PB2_4th Motif Other DBs NCBI-GeneID:  103331274 NCBI-ProteinID:  XP_008232108 LinkDB All DBs Position LG5:9968502..9969842 Genome browser AA seq 156 aa AA seqDB search MASVEMKKITLKSDDGEIFEVEEAVAMQSQTIRHMMEDDCADGAIPLPNVTSNILAKVIE YCRKHKEEAADGENKKDILKEWDAEFVKLDQVTLFHLIMTANYLNIKSLLDLTAQTVAEM IKGKTPEEIRETFNIKNDFTPEEEKKIREENRWAFE NT seq 471 nt NT seq  +upstreamnt  +downstreamnt atggcctccgttgagatgaagaagataaccctgaagagtgacgacggtgagatcttcgag gtggaggaggctgtggccatgcagtcgcagaccatcaggcacatgatggaggacgattgt gctgatggcgcgatacctctgccaaacgtgaccagcaacatcctagcgaaggtgatcgag tactgcagaaagcacaaagaagaggccgccgatggcgagaacaaaaaggacattttgaag gaatgggacgctgagttcgtgaagctggaccaggtcactctgtttcacctaatcatgact gcaaattatctcaacatcaagagcctgctggatttgaccgcccaaactgtggcggagatg atcaagggaaagacacctgaagagatccgtgagacgttcaacatcaagaacgacttcaca cctgaggaagaaaagaagattcgtgaggagaaccggtgggcattcgagtga

DBGET integrated database retrieval system