KEGG   Prunus mume (Japanese apricot): 18668039Help
Entry
18668039          CDS       T03196                                 

Gene name
rbcL, CP95_p059
Definition
(RefSeq) ribulose 1,5-bisphosphate carboxylase/oxygenase large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
pmum  Prunus mume (Japanese apricot)
Pathway
pmum00630  Glyoxylate and dicarboxylate metabolism
pmum00710  Carbon fixation in photosynthetic organisms
pmum01100  Metabolic pathways
pmum01200  Carbon metabolism
Module
pmum_M00165  Reductive pentose phosphate cycle (Calvin cycle)
pmum_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
pmum_M00532  Photorespiration
pmum_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:pmum00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    18668039 (rbcL)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    18668039 (rbcL)
Enzymes [BR:pmum01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     18668039 (rbcL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-GeneID: 18668039
NCBI-ProteinID: YP_009020046
UniProt: W8GN29
LinkDB All DBs
Position
PT
AA seq 475 aa AA seqDB search
MSPQTETKASVGFKAGVKDYKLTYYTPDYETKDTDILAAFRVTPQPGVPPEEAGAAVAAE
SSTGTWTTVWTDGLTSLDRYKGRCYHIEPVAGEESQFIAYVAYPLDLFEEGSVTNMFTSI
VGNVFGFKALRALRLEDLRIPTAYVKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGL
SAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFCAEAIYKAQAETGEIKGHYL
NATAGTCEEMMKRAIFARELGVPIVMHDYLTGGFTANTSLAHYCRDNGLLLHIHRAMHAV
IDRQKNHGMHFRVLAKALRMSGGDHIHAGTVVGKLEGEREITLGFVDLLRDDFVEKDRSR
GIYFTQDWVSLPGVLPVASGGIHVWHMPALTEIFGDDSVLQFGGGTLGHPWGNAPGAVAN
RVALEACVQARNEGRDLAREGNEIIREASKWSPELAAACEVWKEIKFEFEAMDTL
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgtcaccacaaacagagactaaagcaagtgttggattcaaagctggtgttaaagattat
aaattgacttattatactcctgactatgaaaccaaagatactgatatcttggcagcattt
cgagtaactcctcaacctggagttccacccgaagaagcaggggcagcggtagctgctgaa
tcttctactggtacatggacaactgtatggactgacgggcttactagtcttgatcgttac
aaaggtcgatgctaccacatcgagcccgttgctggagaagaaagtcaatttattgcttat
gtagcttaccccttagacctttttgaagagggttctgttactaacatgtttacttccatt
gtaggtaatgtgtttgggttcaaggccctgcgcgctctacgtctggaggatttgcgaatc
cctactgcttatgttaaaactttccaaggcccgcctcatgggatccaagttgagagagat
aaattgaacaagtatggccgccccctattgggatgtactattaaacctaaattggggtta
tccgctaagaattacggtagagcagtttatgaatgtctccgcggtggacttgattttacc
aaagatgatgagaatgttaattcccaaccatttatgcgttggagagaccgtttcttattt
tgtgccgaagcaatttataaagcacaggctgaaacaggtgaaatcaaagggcattacttg
aacgctactgcaggtacatgcgaagagatgatgaaaagagctatatttgccagagaattg
ggggttcctatcgtaatgcatgattacttaacagggggattcactgcaaatactagcttg
gctcattattgccgagataatggtttacttcttcacatccaccgtgcaatgcatgcagtt
attgatagacagaagaatcatggtatgcactttcgtgtactagctaaagcgttacgtatg
tctggtggagatcatatacacgctggtaccgtagtaggtaaacttgagggggaaagggag
atcactttaggctttgttgatttactacgtgatgattttgttgaaaaagatcgaagccgc
ggtatttatttcactcaagattgggtctctctgccaggtgttttgcctgtagcttcaggg
ggtattcacgtttggcatatgcctgctctgaccgagatctttggagatgattctgtacta
caatttggcggcggaactttaggacacccttggggaaatgcacctggtgccgtagctaat
cgagtagctctagaagcatgtgtacaagctcgtaatgagggacgtgatcttgctcgtgag
ggtaatgaaattattcgcgaggctagtaaatggagtcctgaactagctgctgcttgtgaa
gtatggaaggagatcaaatttgaattcgaagcaatggatactttgtaa

DBGET integrated database retrieval system