KEGG   Pasteurella multocida subsp. multocida HN06: PMCN06_0230Help
Entry
PMCN06_0230       CDS       T01776                                 

Gene name
nanB
Definition
(GenBank) sialidase NanB
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
pmv  Pasteurella multocida subsp. multocida HN06
Pathway
Other glycan degradation
Brite
KEGG Orthology (KO) [BR:pmv00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    PMCN06_0230 (nanB)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    PMCN06_0230 (nanB)
Enzymes [BR:pmv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     PMCN06_0230 (nanB)
Bacterial toxins [BR:pmv02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   PMCN06_0230 (nanB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
222862..226044
Genome map
AA seq 1060 aa AA seqDB search
MKKFNPSVLALSISSLLLTSTLTFGQISQQDKALLGVKEHQESLLFHQSLVEQGSENVPI
WRIPSLLRTKDGVLIAAADKRWQHRGDWGDIDTAIRISHDDGKTWGNITTILDLPSQNGD
KSPIHNDAPNFNPWAYRRNGTDSTYRNSSFLIDAQMVQDKRNGRIFLAVDMFPESTGLSG
ATDNGVTEFGSGYVNIGGKSYLQLKNGNTRYTLRENGEVFDQNNNKTDYKVIINGDPKQN
YKDLGNVMNSQGELLGNIYLKKEGKNAKVPFTAPHTSYFWLTHSDDNGKTWSQPIDLTAQ
VKKDWMRFFGTGPGVGIQTQNGNLLFPIYYINRQGKQSAALIISRDGGKTWDLGQSPNDN
RPDLYGQNSETLSRSNAGYELTESQLVELDNGDLKLFMRNTSGRVMMSTSKDGGYTWIDT
QKVDALKHGYSQLSVIKYSKKINGKEYIVFSGQSVEGSGGDDKRRDGKLFLAEVQEDGSI
VWKTNKLVREIQSSGKANRTHPNGYVYSSMAELGDGSIGLAYENTTDYTTIMYLPIEMQE
FFWRDGKIFSDIRQKTPLTVTYNGVDSLEKIGDGIAIKQGVGESLGGVTVSEGTLVLAQK
SEQDKNKAFTDVTLNKTGILQVESVQNIDTLTVNNDALGHIQFRVSDESTPMLNIAKGVS
GKEVKLQVNLQKKLKPNDKGYYHAQGEELITFKDNGQVKWRLVNDELKDGMYVYTLASVA
KPSVLRTTSQPHSLYLTNKLITADGKAVSTIAPLKAPLTVNARPQVNPVLASYLTANLAL
NKMSEQLQQSFMHETRLLQEKDRSIFVKYLNGKQKYGSNLSFIDYGYDFNSSYSGVMLGG
KVWQSEGGNHAVYTALNKTSYKVTPKAVDGETKAKYQSWGGSINWHSHLPHNLIVDLSTG
YQKHKGDIEHAGHVKGYTFNIGADLGYRYQWMKNASITPMVGLHYLYASLSDVNDQANKA
LLKYNHFNALKTNLGVDVNYRIGKFEVKGLLSYDMYQQKTRQLYVDDVAYKQGKLADTLH
LNTQFVAHLTPRFAFSTEVGFQHARNKGQSSFAVGAHYRF
NT seq 3183 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatttaatcctagtgtattggcgttgtccatatcaagtctgctactcacatct
acattgacctttggtcaaatcagtcaacaagataaagcgctccttggtgtgaaagaacat
caagaaagcctactctttcatcagagtttagtagaacaaggcagtgaaaatgtgccaatc
tggcgtattccatctttattaagaacaaaagacggggtattaattgccgccgcagataag
cgttggcaacatcgtggcgactggggcgatattgataccgcaatccgaattagtcatgat
gatgggaaaacatggggaaacattacaacgattttggatttgccatcacaaaatggagat
aaatcacctatacataatgatgctcctaattttaatccttgggcttatcgtagaaatgga
actgattcaacatatcgaaattcatcttttttaattgatgcacaaatggtacaggataaa
cgtaatggtcgtattttccttgcagtcgatatgtttccggaaagtacaggtttatctgga
gcaacagataatggagtgactgagtttggcagtggatatgtaaatattggtggaaaatcc
tatcttcaattaaaaaatggtaatactcgttatacattaagagaaaatggtgaggtattc
gatcagaataataataaaacagattataaagtgattataaatggcgatcctaaacaaaat
tataaagatcttggtaatgtaatgaatagtcagggagagctattaggaaatatttattta
aagaaagagggaaaaaatgcaaaagttccttttactgcaccacatacctcttatttttgg
ttaactcattcggatgataatggtaaaacatggtcacaacccattgatctaacagcacaa
gtgaaaaaagattggatgcgcttttttggtacaggacctggcgttggtattcaaactcaa
aatggcaatttactttttcctatttattacattaacagacaaggcaagcagtctgctgct
ttaattattagtagagatggcggtaaaacatgggatttaggacaaagtccaaatgataat
cgccctgatttatatggtcaaaactcggaaactttatctcgaagtaatgctggttatgaa
ttaaccgagtcacagctagtcgagctagataatggtgatttaaaactctttatgcgcaat
acaagtggtcgagttatgatgtctacttctaaagatggtggctatacttggattgatacg
caaaaagtagatgcgctaaaacatggttattcccaactatcagtcattaaatattctaag
aaaatcaatggtaaagaatatattgtgttttcagggcaatcagttgaaggttcaggaggc
gatgataagcgtcgtgatggtaaacttttcttggctgaagtacaagaggatggctctatt
gtttggaaaactaataagttagtacgagaaattcaaagttctggaaaagcaaatagaaca
catccaaacggctatgtctatagttcgatggcagagcttggtgatggtagtattggatta
gcctatgaaaatacgactgattacacaactattatgtacttaccaattgaaatgcaagaa
tttttctggcgtgatggcaaaatattcagtgatatccgccaaaaaacaccattaactgtt
acttataacggtgtagactcccttgaaaaaataggtgatggtattgcgattaaacaaggt
gtaggagaaagtttaggcggtgtgacagtcagtgaagggaccttagttttagcacaaaaa
tcagaacaagataaaaataaagctttcacagatgtcacactcaataaaacgggtattcta
caggttgaatcagtgcaaaatattgatacattaacagtcaataatgacgcattagggcat
attcaatttcgtgtttcagatgagagtacaccaatgttaaatattgcgaaaggggtatct
ggtaaagaagttaagctgcaagtcaacttacagaaaaagcttaaaccaaatgataaaggt
tattaccatgcccaaggtgaagagctgatcacatttaaggataatggacaagtcaaatgg
cgtttagttaacgatgaattaaaagatggcatgtatgtttatactttggcttcagtggct
aaaccaagtgttttacgtacaacaagtcagccacattcactctatttaacaaataagtta
attacagcggatggtaaagccgtatccaccattgcaccattgaaagcaccattaactgta
aatgctcgcccacaagtgaatccggtattagcctcttatttaaccgccaatcttgccctt
aataaaatgagcgagcaacttcagcaaagttttatgcatgaaacgcgcttattgcaagag
aaagatcgtagtatttttgttaagtatcttaatggtaaacaaaaatatggttcaaactta
agctttattgactatgggtatgattttaattcaagttatagcggtgtgatgttaggaggt
aaagtatggcagtctgaaggtggtaaccatgccgtgtatacagcattaaataaaacatcc
tataaagtgacgccgaaagctgtagatggtgagacgaaagcgaaataccaaagctgggga
ggaagtataaattggcatagtcacttgcctcacaatctgatagtagatttatcaactggc
tatcaaaaacataagggtgacattgaacatgcaggtcatgtgaaaggttatacttttaat
attggtgcggatttaggttatcgctatcaatggatgaaaaatgcgtctattacaccaatg
gtcggtttgcattatttatatgcctcgctttcagatgtcaatgaccaagcgaataaagcg
ttattgaaatataatcatttcaatgcgttaaaaacgaatttaggtgttgatgtgaactat
cgaatcgggaagtttgaagtaaaaggtctactttcttacgatatgtatcaacaaaaaaca
cgtcaattgtatgttgatgatgttgcatataagcaaggtaaactggctgatacacttcat
ttaaatacacaattcgttgcccatttaacgccacgttttgcattttcaacggaagttggt
ttccagcatgcacggaataaagggcagtcttcctttgctgttggggcacattatcggttc
taa

DBGET integrated database retrieval system