KEGG   Paenibacillus mucilaginosus K02: B2K_27485Help
Entry
B2K_27485         CDS       T02041                                 

Definition
(GenBank) cytochrome C oxidase subunit II
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
pmw  Paenibacillus mucilaginosus K02
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pmw00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    B2K_27485
Enzymes [BR:pmw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     B2K_27485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
6520397..6521953
Genome map
AA seq 518 aa AA seqDB search
MSRIWSRRKTAKVIVSAALAFTLIASPGTEKAHAHHDGSNGVMMQYFEWYLPNDGTLWSK
LQTNAAALKSAGVTAVWIPPAYKGGGSGDVGYGVYDMYDLGEFNQKGTVRTKYGTKDQLI
SAVDTLHANGMQVYGDVVLNHRMNADATETVTAVEVNPSDRNSEISGEYSISAWTQFHFP
GRNNAYSSFKWKWYHFDGVDYDQSRNANKLFKLRGTGKSFDWEVDTENGNYDYLMGADLD
WDHPEVISETRTWGNWFVNTAKLDGVRIDAVKHIKFDRMRDWLNGVRTDTGKSLFAVGEY
WSGDINKLNNYMTKTSGAMSLFDVPLHYNLYAASNGSGGYDMRNILNNTLLKTNPTKAVT
FVDNHDSQPGQALQSTVQGWFKPLAYALILTRQEGYPSLFYGDYYGTSDGKIASFKTVLD
KLLAARKTYAYGKQNDYLDHQDIIGWTREGDAAHANSGLAALVTDGPGGSKRMYVGTGKA
GQVWNDKTGNRTDTVTIDGSGYGTFPVNGGSVSVWAKQ
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgtcccggatttggtcccggcgtaaaaccgcaaaagttattgtaagcgctgccttggcc
ttcaccctgatcgcctcccccggcacagaaaaagcccatgcccaccatgacggcagcaac
ggtgtcatgatgcagtatttcgaatggtatctcccgaatgacgggaccctgtggagcaag
ctgcagacgaatgcggccgccctgaagagcgccggcgtgacggccgtctggatcccgcct
gcatacaagggcggaggcagcggcgacgtcgggtacggggtctacgacatgtacgacctc
ggcgagttcaaccagaaaggcactgtgcgtaccaagtacggcacgaaggatcagctgatc
agcgccgtggataccctgcacgcgaacggcatgcaggtgtacggggatgtcgtgctcaac
caccggatgaacgccgacgccaccgagacggtcacagcggtggaagtgaatccgtccgac
cgcaacagcgaaatctcgggagaatactccatttcggcatggacgcagttccattttccg
gggcgtaataatgcgtactcctccttcaagtggaaatggtatcatttcgacggcgtggac
tacgatcaatcacggaatgcgaacaagctcttcaagctccgcggcaccggcaaaagcttc
gactgggaggtcgatacggagaacggcaactacgactatctgatgggcgcggacctcgat
tgggatcatccggaagtcatcagcgaaacgcgcacctgggggaattggttcgtcaacacg
gcaaagctcgacggcgtccgcatcgatgccgtaaagcacatcaaattcgaccggatgcgc
gactggctgaacggcgtgcggaccgatacggggaagagcctgttcgctgtaggcgaatac
tggagcggggatattaacaagctgaacaattatatgaccaaaacgagcggtgccatgtcc
ctcttcgacgttccgctgcattataacctgtacgcggcttcgaacggcagcggcggctat
gacatgcggaacattctgaataacacgctgctcaagaccaatccgacgaaagccgtcacc
ttcgtggacaaccatgactcccagccggggcaggcgctccaatccaccgtacagggctgg
ttcaagccgctcgcctacgcattgatcctcacccgccaggaaggatatccgtccttgttc
tacggcgattactacggcacgtcggacggtaagatcgcttcgttcaaaaccgttctggac
aagctgctcgcagcgagaaaaacgtatgcctacggcaagcagaacgactatctcgaccac
caggacatcatcggctggacccgtgagggcgatgccgcccatgcgaactccggcttggcc
gcgctcgtgaccgacggaccgggaggcagcaagcggatgtatgtaggcactgggaaggcc
ggccaggtgtggaacgacaagaccggcaaccggacggataccgtgacgatcgacggcagc
ggctacggcacattcccggtcaacggcggctccgtatccgtatgggcgaagcagtag

DBGET integrated database retrieval system