KEGG   Pseudomonas aeruginosa NCGM2.S1: NCGM2_3926Help
Entry
NCGM2_3926        CDS       T01974                                 

Definition
(GenBank) putative glutathione S-transferase
Organism
pnc  Pseudomonas aeruginosa NCGM2.S1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_3 GST_C GST_C_2 GST_N_4 Tom37
Motif
Other DBs
NCBI-ProteinID: BAK90764
LinkDB All DBs
Position
1:4255236..4255898
Genome map
AA seq 220 aa AA seqDB search
MSLTLYGAPLSPFVRKVRLLLAEKGLDYQLEAIAPFGQPAWYREISPLGRIPALRDGDLA
LADSSVICQYLEERYPEPPNLQGDAPAGRAAVRWLEKYADYEIAPLATLTIFRNRILKPA
MGQACEENDVRRALEEKLPAHFDYLENHLDGRAFFVGERLTLADLAIASQLVNLRHAGEN
LDEQRWPALAVHFARMLERPAMQALLPGERRTLDKLAAKA
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgacactctacggagccccgctgtctccgttcgtccgcaaggtccgcctgctc
ctggccgaaaagggcctcgactaccagttggaagcgatcgccccgttcggccagccggcc
tggtatcgcgagatcagtccgctgggccgcatcccggcgttacgcgacggcgacctggcc
ctcgccgactccagcgtgatctgccagtacctggaagaacgctatcccgaaccgccgaat
ctccagggcgacgcccccgccggccgcgcagcggtgcgctggctggaaaaatacgccgac
tacgagatcgctcccctggccacgctgacgatcttccgcaaccggatactcaagccggcg
atgggccaggcctgcgaggagaacgacgtgcgtcgcgcgctggaggaaaagctgccagcg
cacttcgattacctggaaaaccatctcgacggccgggccttcttcgtcggcgagcgactg
accctcgccgacctggcgatcgccagccagttggtcaacctgcgtcacgccggcgaaaac
ctggacgagcaacgctggccggccctcgccgtgcatttcgcgcggatgctcgaacgcccg
gcgatgcaagcgctgctgccgggggaacgacggaccctcgacaagctcgcagcgaaagcc
tga

DBGET integrated database retrieval system