KEGG   Parastagonospora nodorum: SNOG_15514Help
Entry
SNOG_15514        CDS       T01161                                 

Definition
(RefSeq) hypothetical protein
  KO
K00693  
glycogen synthase [EC:2.4.1.11]
Organism
pno  Parastagonospora nodorum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pno00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SNOG_15514
Enzymes [BR:pno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     SNOG_15514
Glycosyltransferases [BR:pno01003]
 Polysaccharide
  Storage polysaccharide
   SNOG_15514
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 707 aa AA seqDB search
MAETTTRDVNNHVLFEVATEVANRVGGIYSVLKSKAQVTTAEYGASYTLIGPWNRASASV
EVEPIEPKDPALVATIKSMQDRGVQTLYGRWLIDGAPRVLLFDTGTGYRWLDEWKGDLWS
SAGIPSPPGDSETNEAIVFGYLVAWFLGEYVFHEKKRAVIVQFHEWLAGVAVPLCKKRRI
DVTTIFTTHATLLGRYLCAGSVDFYNNLQFFDVDAEAGKRGIYHRYCIERAATHAADVFT
TVSHITAYESEHLLKRKPDGVLPNGLNVKKFSATHEFQNLHQQAKVKINDFVRGHFYGHN
DFDPENTLYFFTAGRYEYRNKGVDMFIESLARLNHKMKSENSNMTVVAFIILPAQTQSLS
VASLKGQAVIKSLHDTVNNIAENVAKKLFERSLTWTEGQDLPEDKDLISPADKILLRRRL
FAMKRHDLPPIVTHNMVNDAEDPVLAQLRRCQLFNHPSDRVKVVFHPEFLNSANPVLPLD
YDDFVRGTHLGVFSSYYEPWGYTPAECTVMGVPSITTNLSGFGCYMEELIENASDYGIYI
VDRRMKGVDDSVNQLVDYMFDFTKKSKRQRINQRNRTERLSDLLDWKRMGLEYVKARQLA
LRRAYPGSYEDDEEPDFFGSQEVKISRPLSEPGSPRDRSGMMTPGDFASLQEGREGLSTE
DYIAWKLPEEEEPDDFTFPLTLKTKSKPNSGANTPTIINGTDGLSLN
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atggctgagacaacgacgcgggacgtcaacaaccacgtcctctttgaggttgcgactgag
gttgcgaaccgagttggcggtatctactcggtcctcaagtccaaggcccaggtcaccacc
gccgagtatggcgcgtcctacacgctcattgggccgtggaacagggcatctgcctcggtc
gaagttgagccgatagaacccaaagacccggctctcgtagccaccatcaagtcgatgcag
gatcgcggcgtccagaccctgtatggacgatggctgattgacggcgcaccacgtgtgctc
ctcttcgacactggcacgggctacagatggctcgacgagtggaagggtgatctgtggtcg
agtgctggcattccttcgccgccgggcgactcggagaccaacgaggccattgtcttcgga
taccttgttgcatggttccttggcgagtacgtcttccacgagaagaagcgagccgtcatt
gttcagttccacgagtggctcgcaggtgttgcggtcccgctctgcaagaagcgccgcatc
gatgtgaccaccatcttcaccacgcacgctacccttctcggtcgctacctgtgcgcgggc
tctgtcgacttctacaacaacctgcaattcttcgatgtagacgccgaggcaggaaagcgc
ggcatctaccacaggtactgcatcgagcgcgctgccacccacgccgccgatgtcttcacc
accgtgtcgcacatcaccgcatacgagagcgagcatcttctgaagcgaaagccagatggt
gtcctgcccaatggtctgaacgtcaaaaagttctcggccacgcacgagttccagaacttg
caccagcaggcaaaggtcaagatcaatgactttgtacgtggacatttctacggccacaac
gacttcgatccagagaataccctctacttcttcactgccggtcgctatgaatacaggaat
aagggtgtcgacatgttcatcgaatcattggcgcgattgaaccacaagatgaagagcgag
aactccaacatgacagttgtcgccttcatcattcttcccgcacagacacaatccttgtca
gtcgcctccctcaagggacaggctgtcatcaagtctctgcatgacactgtcaacaacatc
gccgagaatgtggccaagaagctatttgaacgctctttgacttggactgaaggccaggat
ctgccagaggacaaggacctcatctcgcccgcagacaagatcctccttcgtcggcgatta
tttgccatgaagcgacacgacctgccgccgattgtcactcacaacatggtcaacgacgct
gaagacccagtactggctcagctccgccgctgccagctgttcaaccacccctcggaccgt
gtcaaggttgttttccaccccgagttcctgaactcggcgaacccagtacttcccctcgac
tacgacgacttcgtccgcggaactcatcttggtgttttctcatcgtactacgagccatgg
ggctacactcccgccgagtgtaccgtcatgggagtaccaagtatcaccaccaacctgtcc
ggtttcggttgctacatggaagagttgattgaaaacgcctccgattacggtatctacatt
gttgaccgaagaatgaagggtgttgacgactctgtaaaccagcttgtggactacatgttc
gacttcaccaagaagagcaagcgccagcgcatcaaccagcggaaccgaacagaacgcctg
agcgatttgcttgactggaagcgcatgggtctcgagtacgtcaaggcgcgacagctcgct
ctccgccgggcctaccccggctcgtacgaggatgatgaggaacccgactttttcggctcg
caagaagtcaagatctcacgaccgctgtctgagcccgggtcgccgcgtgaccgatccggc
atgatgacgcctggtgactttgcctcgttgcaagaaggccgcgagggcctgagcaccgag
gactacattgcgtggaagcttcctgaggaggaagagcccgatgactttacgttcccgctc
actctcaagacgaagagtaagcctaattcaggcgccaacacacccaccatcattaatggt
accgatggtctcagtcttaactaa

DBGET integrated database retrieval system