KEGG   Paenibacillus naphthalenovorans: IJ22_38190Help
Entry
IJ22_38190        CDS       T04167                                 

Definition
(GenBank) alanine racemase
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
pnp  Paenibacillus naphthalenovorans
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pnp00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    IJ22_38190
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    IJ22_38190
Enzymes [BR:pnp01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     IJ22_38190
Peptidoglycan biosynthesis and degradation proteins [BR:pnp01011]
 Precursor biosynthesis
  Racemase
   IJ22_38190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(3798875..3800062)
Genome map
AA seq 395 aa AA seqDB search
MDSFYRPTRVEISLDALRHNLEEFRRVLPEHVSMMAVVKADAYGHGAVEVCREALSSGVK
YIAVAFLDEGLELRQAGITAPILVLGYTPPEGLETAWENDITLNVYTHELLDAWERLGPR
ERPLNIHIKIDSGMNRLGLTEEHEAIELIERAMRIPGLRVEGLFTHYACADETDKSYTLE
QYGRFERVVEHFHRQGIRFPWVHAGNSAAAIDTPNLTYNMVRLGISMYGLYPSEEVNQQI
IDLQPVLSIKSAVVMVKKVPPGAGVSYGAIYRTEGEETIATLPIGYADGFSRILTGKAQV
LIKGQRVPIVGRICMDQCMMNVTGLADISVEEEVVILGSQGEERITAEEHAQWLGTINYE
VICMISHRVPRVYIKEGRVSHTVNPLLRHRWERTE
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
gtggattcgttttaccggccgacgcgggtagaaatttcgcttgatgcactgcgtcacaac
ctggaggagtttcgaagagtacttcctgagcatgtaagcatgatggctgtcgtcaaagcg
gacgcctatggccacggcgccgtagaggtttgcagggaggcgcttagcagcggtgtgaag
tatattgctgtagcttttttggacgagggccttgagctgaggcaagcgggaataacagcg
ccgatcctggtgttgggttatacgccgcctgaagggctggagacggcctgggagaacgat
attacgctaaatgtttacacgcatgagctgttggatgcttgggagcgtttggggcccagg
gagcgtccgctgaacattcatattaagattgactccggcatgaaccggctcgggttgact
gaagagcatgaagcgattgaactgattgaacgggcgatgcggatacccgggctgcgggtg
gaagggctgttcacccattatgcttgcgcagacgagacggataaaagctatacactggag
cagtacggtcgctttgaacgggtggtggagcattttcaccgtcaaggaatccggttcccc
tgggtgcatgcgggcaacagtgccgcggcgatcgatacgccgaatttgacgtataatatg
gtacggctcgggatcagcatgtacggcttgtacccttcggaggaggtcaatcagcaaatc
attgatcttcagccggtactaagcatcaaatcggccgtagtcatggtcaaaaaggtgcct
cccggcgcaggtgttagctatggcgcgatttaccggacagagggcgaagaaacaatcgct
acgctgccgatcgggtatgcggacggattctcgcgaatactgacgggcaaggcgcaggtg
ctgatcaaaggacagcgtgtgccgatcgtgggcagaatttgtatggatcaatgtatgatg
aatgtgacgggtcttgccgatatatctgtcgaagaagaagtcgtcattctgggaagtcag
ggagaagagcgaattacggcggaggagcatgctcagtggcttggaaccatcaattacgaa
gtcatctgcatgatctcgcaccgcgttccgcgagtttatatcaaagaggggcgcgtctcg
catacggtcaatccgctgctccggcataggtgggagcggacagagtaa

DBGET integrated database retrieval system