KEGG   Paenibacillus naphthalenovorans: IJ22_46680Help
Entry
IJ22_46680        CDS       T04167                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pnp  Paenibacillus naphthalenovorans
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:pnp00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    IJ22_46680
  Energy metabolism
   00680 Methane metabolism
    IJ22_46680
Enzymes [BR:pnp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     IJ22_46680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
4635814..4638600
Genome map
AA seq 928 aa AA seqDB search
MSESASLINKNTSNNLLRRDVRFLGHILGEMLVHQGGNELFTIVEKIREMSKSLRAQYSP
EMYAELKNTMNGLAPEIRYQVIRAFAIYFQLVNIAEQNHRIRRKRDYERTAGESVQPGSI
EDSIRELKNLGISFAEVQEMIQGISLELVMTAHPTEATRRAVLDIHKRIANDVMELDNPN
LTFREREQLREKLLGEVITLWQTDELRDRKPTVIDEVKYGLYYFDETLFDVLPQVYQELE
RCLHKYYPEESWYVPTFLKFGSWIGGDRDGNPSVTSKITWQTLTMHRNLVLKKYEEQLTG
LMRHMSFSKNIVEVTKELLDSIEKDRSNVILPPDVVWRNEKEPYRIKVKYMIQKIRNTAD
PNVGEGQKYNNPSEFMEDLLVIERSLRNHYADFIADTYVRTIIRQVELFGFHLVTLDIRQ
HSKEHESAMTEILAKMSICPDYGALTEEQKIELLTGILNDPRPITSPYLHYTESTQECLD
VYRVIRKAQQEFGRSCISSYLISMTQGASDLLEVLVFGKEAGLYQHEEDGSITCTLQSVP
LFETIDDLHAAPEIMTTLFQIPAYRNSLNSTNHLQEIMLGYSDSNKDGGVITANWELRVA
LRSITAAAKPFGVKLKFFHGRGGALGRGGMPLNRSILAQPADTVGGGIKITEQGEVLSSR
YSMKGIAYRSLEQATSALITSALWAKNPQINDAEQGWEEIMSRISEKAQQKYQDLIFRDP
DFLTFFKETTPLPEIGELNIGSRPSKRKNSDRFEDLRAIPWVFAWTQSRYLLPAWYASGY
GLNSFYQENPDNLKIMQDMYQHWSFFRSLIDNLQMALAKADLVIAKEYSSLIHDQGIAER
IFNLIQDEYRQTSELILKITGQQEILDNVPVIQESIRLRNPYVDPLSYMQVGLLSELRSL
REQGDADSLLREVLLTINGIAAGLRNTG
NT seq 2787 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaatcagctagtttaatcaacaaaaacacgtccaacaatctgctgcgcagagac
gtacggtttctcgggcatattttgggcgaaatgcttgtgcatcagggcggcaatgagctg
tttactattgtagagaaaatcagagagatgagtaaatcgcttcgcgcccaatattcaccg
gaaatgtatgccgaacttaaaaacacgatgaacggcctggcgccggaaatccggtatcag
gtgatccgcgcatttgctatttatttccagttggttaatattgccgaacaaaaccaccgt
attcgccgtaagcgtgactatgagcgtacggcgggagaaagcgtgcagcccggatcgata
gaggattcgattcgtgagctgaaaaatcttggcatcagctttgccgaagtgcaggagatg
attcagggcatctcgctggagcttgtcatgaccgcgcatccgacggaagcgacccgccgc
gcggtgctcgatattcataagcgcattgccaacgacgttatggagctggacaacccgaac
ctgacgttccgcgaacgggagcagctgcgggagaagcttctcggtgaggtcatcaccctc
tggcagacggatgagctgcgggaccgtaaacctacggttattgacgaagtcaagtacggc
ctttattattttgacgaaaccttgttcgacgtgcttcctcaagtgtatcaggagctggag
cgctgtctgcacaaatattatccggaagagtcgtggtacgtgccgacgttcctgaaattc
ggctcctggatcggcggcgatcgcgacggcaatccgtcggttacctccaagattacgtgg
cagacgctcacgatgcaccggaatctggtcttgaagaaatatgaagagcagctgaccgga
ctcatgcggcacatgagcttcagcaagaatatcgtcgaggtgacgaaagagctgctggat
tccattgaaaaggaccgcagcaacgtcattcttcctccagatgtggtatggcgcaacgag
aaagagccttatcgcattaaagtaaagtatatgattcagaaaatccgaaatacggccgat
ccgaacgtcggagaagggcaaaaatacaacaatccgtctgagttcatggaagatctgctg
gtgatagaacgcagcctgcgcaatcactatgccgattttatcgccgatacgtatgtacgg
acgatcattcgtcaagtcgaattgttcggcttccaccttgttacgttagatataaggcag
cacagcaaggagcatgaatcggccatgacggagatattggccaaaatgagcatttgtccg
gattacggagctttgacggaagagcaaaaaatcgagctgctgacaggcatcctgaacgat
cccagaccgattacatcaccgtaccttcactataccgaatcgacacaggagtgcctggac
gtgtatcgcgtgatccgcaaagcccagcaggaattcggccggagctgcatctccagttac
ttgatcagtatgacccagggggccagcgatcttctggaagtgctcgtcttcggtaaagaa
gcggggttgtatcagcatgaagaggacggttcgattacctgcacgctgcagtccgttccc
ctgttcgaaacgatcgacgacctgcatgcggccccggaaattatgacgacgctgttccaa
attcctgcgtaccgcaacagcttgaacagcacgaaccacctgcaggaaatcatgctcggt
tattccgacagcaacaaggacggcggtgtgattaccgccaactgggaactgcgcgtggcg
ctgcgcagcattacggccgcggccaagccgttcggcgtgaagctgaagtttttccatggc
cgcggaggtgcgctcggccgcgggggaatgccgcttaaccgcagtatcctggcgcagcct
gcagatacggtcggcggcggcatcaagattacggagcagggcgaggtgctttcttcgcgt
tattcgatgaaaggcatcgcgtaccgcagtctggagcaagcgacatccgcgctgattacg
agcgctttgtgggcaaagaacccgcaaatcaacgatgccgagcaaggctgggaagaaatt
atgtccaggatttccgagaaggcgcagcagaagtatcaggatttgatcttccgcgatccg
gatttcctgacgttcttcaaggaaacgacgccccttccggagattggcgagctgaacatc
ggttcccgtccgtccaaacgcaagaacagcgaccgttttgaggatctgagggccatcccg
tgggttttcgcgtggacgcagagccggtatttgcttccggcctggtacgcttccggttac
ggtttgaacagcttctatcaagaaaatccggacaatctgaaaatcatgcaggatatgtat
cagcattggtcattcttccgctcgctgatcgacaaccttcagatggcgctggccaaggcg
gaccttgtgattgccaaagaatacagcagcttgattcacgatcagggcatcgctgaacgt
attttcaatctgattcaagacgagtaccgtcaaacctcggagctcattttgaaaattacc
ggtcaacaggaaattctcgacaacgtaccggtgattcaggagtcgatccgcttgcgcaac
ccatacgtcgatccgctcagctatatgcaggtaggcctcttgtcggagcttcgttcgctg
cgggagcagggggatgccgattcgctgctgcgtgaggtgctgttgacgatcaacggcatt
gccgcaggccttcgcaatacgggctga

DBGET integrated database retrieval system