KEGG   Polaribacter vadi: LPB03_09075Help
Entry
LPB03_09075       CDS       T04504                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pob  Polaribacter vadi
Pathway
pob00620  Pyruvate metabolism
pob00680  Methane metabolism
pob01100  Metabolic pathways
pob01120  Microbial metabolism in diverse environments
pob01200  Carbon metabolism
Module
pob_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:pob00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    LPB03_09075
  Energy metabolism
   00680 Methane metabolism
    LPB03_09075
Enzymes [BR:pob01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     LPB03_09075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 DUF4378 ECH_1
Motif
Other DBs
NCBI-ProteinID: AOW17608
UniProt: A0A1B8U3Q3
LinkDB All DBs
Position
2030396..2032975
Genome map
AA seq 859 aa AA seqDB search
MSALPELTRFNDNVLSKYQIYNSIFITLPFDTIDNTGVLLPLFHKICEKGFEQGKNPTEI
VEEFFSKYQDSSEGKNKTDLLFQFIQYIERQVVLFDAIEDAAFPIVNNMDGIGTLRNSKE
IAILNDKKEELKKHLEDFKVRVVLTAHPTQFYPGSVLGIITDLDQAIQNDDLLLIKKLLA
QLGKTPFYKKTKPTPYDEAISLIWYLENVFYHSVPKIYNYIQHNVYDGHPIDNEIIDLGF
WPGGDRDGNPFVTTQITLDVAERLRQSILRNYYRDVRRLKRRFTFDGVHEILSKIEKRLY
KHVIRSYSKVNFSQKILLEELYAARDIITENHNSLFIEELNDFINKVRIFGFHFATLDIR
QDSRVHHKAFTQIVEDLLASGDATFPKNYHQLSEDDQIKVLAEIKGTIDPAILSDEMSVK
TIESIYALKTIQQRNGERGANRYIISNNQTTLNVMQTFAMLNLCGFENELPVDVIPLFET
VDDLENASDVMRTLYTNNTYRYHLSKRKNKQTIMLGFSDGTKDGGYLMANWGIFKAKEAL
TKISREFDIEVIFFDGRGGPPARGGGKTHQFYASLGPTIEDKEIQLTIQGQTISSNFGTL
NSSQYNLEQLISSGIKNEVFTKDQLNDAHRTIIDDLAKTSYKTYVDFKNHPQFLPYLEQM
STLKYYAKTNIGSRPSKRSNSDTLDFSALRAIPFVGSWSQLKQNVPGFYGVGTALKKYED
ANRFDEIVEFYNASDFLKTLLENSMMSLTKSFFGLTAYMADDEVFGEFWTLIYEEYKTTK
RLLLKLAGHTVLMENHPVGKASIEIRESIVLPLLTIQQYALKKIQELQKSEGNEAEIEIF
EKMVMRSLFGNINASRNSA
NT seq 2580 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcattacccgaattaacaagatttaatgacaatgtgttgtctaaatatcaaatt
tataacagcatatttattacacttcctttcgatacgattgataacacaggtgttttatta
ccactttttcataaaatttgtgaaaaaggatttgaacaaggaaaaaatcctacagaaatt
gtagaagagtttttttctaaatatcaagattcatcagaaggaaaaaataagaccgattta
ctttttcaatttatacaatatatagaacgtcaagtagttttatttgatgctattgaagat
gctgcttttcctattgtaaataatatggatggaattggaaccttaagaaactcgaaagaa
attgccattttaaatgataaaaaagaggaacttaaaaagcatttagaagattttaaagta
cgtgttgttttaacggcacatcctacacaattttatcctggttctgttttaggaattatc
acagatttggatcaagctattcaaaatgacgatttattattgataaaaaagctattagct
caattagggaaaacgcctttttataagaagacaaaaccaactccttatgatgaagctatt
agtttaatttggtatttagagaatgtattttatcattctgtaccaaaaatttacaactat
attcagcataatgtttatgatggacatcctattgataatgaaattatcgaccttggtttt
tggcctggaggagatagagatggaaacccatttgtaaccacacaaattacgttagatgtt
gcagaaagattgcgtcaatcgattttaagaaattattatagagatgtaagacgtttaaaa
agacgttttacttttgatggcgttcatgaaattttaagcaaaatagaaaaacgtttatac
aagcacgttattagaagttattctaaggtaaatttctctcaaaaaatattattagaggaa
ttatatgcagctagagatatcattaccgaaaaccataattccttatttattgaagaatta
aacgattttataaacaaagttagaatcttcggttttcactttgcaacgttagatattcgt
caagatagtagagtacatcacaaagcatttacgcaaattgtagaagatttattagcttct
ggagatgcaacatttcctaaaaattatcatcaattatcagaagatgatcaaattaaagtt
ttagcagaaattaaaggaactatagatcctgcaattttgtctgatgaaatgtctgtaaaa
acgatagaatctatttatgctttaaaaactattcagcaaagaaatggagaaagaggtgca
aataggtatattattagcaacaaccaaactactttaaatgtgatgcaaacttttgcaatg
ctaaatttatgtggttttgaaaacgaattgccagttgatgtaattccgctttttgaaaca
gttgacgatttagaaaatgcaagtgatgtaatgcgcactttatacaccaataatacatac
agatatcatttatcgaaaaggaaaaataaacaaactattatgttaggtttttctgatgga
acaaaagatggtggttatttaatggcaaattggggaatttttaaagccaaagaagcctta
acaaaaatttctagagaatttgatattgaagtaattttctttgatggacgaggaggacca
cctgcaagaggaggaggaaaaacgcatcaattttatgcttctttaggcccaacaattgaa
gataaggaaattcaattaaccattcaaggacaaacgattagttctaattttggaacctta
aattcttctcaatataatttagaacaattaataagttcaggtattaaaaacgaagttttt
acaaaagatcaattaaatgatgctcatagaactattattgatgatttagcaaaaacgagt
tataaaacctacgttgattttaaaaatcatccgcagtttttaccttatttagagcaaatg
agtaccttaaaatactatgcaaaaactaatattggaagtagaccaagcaagcgttcaaat
tctgatacgttagatttttcagctttaagagccattccttttgtcggtagttggagtcaa
ttaaaacaaaacgttcctggtttttatggagttggaactgctttaaaaaagtatgaagat
gctaacagatttgatgaaattgtagagttttacaatgcttcagatttcttaaaaacactg
ttagaaaacagtatgatgagtttaacaaaatctttctttggtttaactgcttacatggct
gatgacgaagtttttggagaattctggacactaatttacgaagaatataaaactacaaaa
cgtttgttattaaaactagcaggacatacagtgttgatggaaaatcatcctgttggaaaa
gcatctattgaaattagagaaagtattgttttgccattgttaactattcagcaatatgct
ttaaagaaaattcaagaattgcaaaaatcagaaggaaatgaagctgaaattgaaatcttt
gaaaaaatggtaatgcgttctttatttgggaatattaatgctagtaggaattctgcttag

DBGET integrated database retrieval system