KEGG   Polaromonas sp. JS666: Bpro_3393Help
Entry
Bpro_3393         CDS       T00343                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
Organism
pol  Polaromonas sp. JS666
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
3586484..3589312
Genome map
AA seq 942 aa AA seqDB search
MNVDSPSRAVSDEAVLRIVREVLTELHPGRKDTDLVTLDSSLEEDLGLDSLARVELLMRL
ERAFGVRPPEHMLSTAEAPRDLLRALLAARGSPQAPVQQARRLAVPERVSQAPHAAATLQ
EVLDWHVRAHPQREHIAIDNGDSAAPTRLSYADLQQGAAGVAAGLLDRGFQPGQPVALML
PTGPEYFFSFAGILLAGGIPVPIYPPARAAQIEEHLQRHVGILTNALATALITVPRARVL
ATLLKSQVPSLRMVCTVEELSASTASPERVTAHANDIALLQYTSGSTSSPKGVVLTHANL
LANLRAMGQALQVSSEDVFVSWLPLYHDMGLIGAWLGSLYYAYPLVVMSPLTFLARPERW
LWAVHRHRGTLSGGPNFGYELCLRKLDEAALEGLDLSSWRFAFNGAEPVSATTMQEFQQR
FACYGLRPQALAPVYGLAEATLGLTFPPQGRGLLVDRIDTQAFSHSGRALPAASSTSGVR
LVVACGRPLPGHEVRLVDATGCEVAERQEGRLLFKGPSATSGYFRNPKETRRLFDGEWLD
SGDYAYMAQGDVYITGRAKDVIIRGGRQIYPYDLEEAVGAIPSVRKGCVAVFGSPDPMTR
SERVVVMAETRGLPPEALAQLRRQINSAAVGVLGAPPDDVVLVPPHTVLKTSSGKIRRAA
SRELYETGGASATQPAPWQQIARFAWQARLPQLRRAGRVVAEIAYAGYVWLLFWLLAPIT
WALTAVLPKLSWSWALSHHAARLFLRLSGLPFAAEGLANLPREASCVVVANHASYLDGIT
LVAALPRHVRFVAKLELQKQFISRVYLQGLGAMFVDRDDAQRGAQDVARVTRSVCDETAM
LFFPEGTFRRVPGLLPFHAGAFSAAAQAGVPVVPVTIRGTRSVLRAGQWFPRRVPISVLV
SSPIQPDGDDWSASIRLRDAARAEILKRCAEPDAGDESRLPS
NT seq 2829 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtagactcgccttcccgcgcagtgtccgacgaggctgtgttgcggatcgtgcgg
gaagtcttgaccgaactccacccgggccgcaaggacacggacctggtgacgctggacagt
tcgctggaggaagaccttggcctggacagcctggcgcgcgtggagttgttgatgcgcctc
gaacgcgcgttcggcgtgcgcccgccggagcatatgctgagcacggccgaagcgcctcga
gacctgctgcgtgcgctgcttgccgcacggggctcaccccaggcgccagtgcagcaggca
cggcggcttgcggtgcccgaacgcgtctcgcaagcgccgcacgcggcggcgaccctgcag
gaggtgctcgactggcacgtgcgggctcatccgcagcgcgagcacattgcgatcgacaac
ggcgacagcgccgcaccgacgcgcctgagctacgccgacttgcagcagggcgccgctggc
gtcgctgcggggctgctggatcgcggctttcagccgggtcagccggtggcgctcatgctg
ccgaccggcccggagtacttcttcagcttcgccggcattctgctggccggcggcattccg
gtaccaatctacccgccagcgcgggcggcgcagatcgaggagcacctgcagcgtcacgtc
ggcatcctcaccaatgcgctggccacggcgctgatcactgtgccgcgggccagggtgctg
gcgacgctgctcaagtcccaggtgccgtcgctgcgcatggtctgcacggtggaagaactg
tccgcgtccaccgcctccccggaacgcgtcaccgcccatgccaacgatattgccctgctg
cagtacacctccggcagtaccagcagtcccaagggggtggtcctgacgcacgccaacctg
ctggccaacctgcgggccatggggcaggccctgcaagtcagctccgaagacgtcttcgtc
tcgtggctgccgctgtaccacgacatggggctgatcggggcttggctgggcagcctgtat
tacgcatacccgctggtggtgatgtcgccgctgacatttctcgcgcgacccgagcgctgg
ctgtgggccgtgcaccggcaccgcggcacgctgtccggcgggcccaacttcggctacgag
ctgtgcctgcgcaagctcgacgaggccgcgctggaggggctcgacctgtccagctggcgc
tttgcgttcaacggcgccgagccggtcagcgcgacgaccatgcaggagtttcagcaacgc
ttcgcctgctacgggctgcggccgcaagcgctggcgccggtgtacggactggcggaggca
acgctgggcctgaccttcccgccgcagggacggggtctgctggtcgaccgcatcgatacg
caagcgttctcgcactcgggccgcgcactgcccgcggcgagcagcacgtctggcgtgcgg
ctggtcgtagcgtgcggacggccgctgccgggccatgaggtccgcctggtcgacgcgacg
ggatgtgaggtggcggaacgccaggaagggcgtctgctgttcaagggtccgtcggccacc
agcggctacttccgcaacccgaaagagacgcgccggctgtttgatggcgagtggctggac
tcgggcgactacgcctacatggcacaaggcgacgtctacatcaccgggcgggccaaggac
gtgatcattcggggcggccgtcagatctacccgtacgacctggaggaggccgtcggcgcg
attccctctgtccgcaagggctgcgtcgccgtgttcggtagcccggaccccatgacacgc
agcgagcgggtcgttgtcatggcggaaacccgtggcctgccgcccgaggcgctggcgcag
ctgcgccgccagatcaacagcgccgcggtcggcgtgctcggtgcgccgccggacgacgtg
gtcctggtgccgccgcacacggtcttgaagacctccagcggcaagattcgtcgcgcggcc
agccgcgaactgtacgagaccggaggcgcttcggccacgcagccggcgccatggcagcag
atcgcgcgctttgcctggcaggcgagactgccgcaactgcggcgtgccgggcgcgtcgta
gcggagatagcctacgctggctatgtctggctgctgttctggctgcttgcgcctattacg
tgggcgctgaccgccgtgctgcccaagctgtcctggagctgggccctgagtcaccatgca
gcccggctgttcctgcgtttgtccgggctcccgtttgcggccgaggggctggcgaatctg
ccgcgcgaggcaagctgtgtggtggtggcgaaccatgcgagctacctggatggcataacc
ctggtcgccgcactgccgcgccatgtccgctttgtcgccaagctcgaactgcagaaacag
ttcatctcacgggtctacttgcaaggcctcggcgccatgtttgtagaccgcgacgacgcg
cagcgcggggcgcaggacgtcgcgcgggtgacgcgcagcgtttgcgacgaaaccgccatg
ttgtttttcccggaaggaacgttcaggcgtgtgccaggcttgttgccgttccatgcgggc
gcgttctctgcggcagcgcaggccggcgtgcccgtggtgccggtgacgatccgcggcacg
cgctccgtgctgcgtgccggccagtggttcccccgccgcgtaccgatcagcgtgctggtc
agttccccgattcaacccgatggtgacgactggtcagcgtcgatccggttgcgcgacgcc
gcgcgcgcggaaatcctgaagcgctgcgccgagccggatgccggcgatgaaagccgcctg
ccttcgtaa

DBGET integrated database retrieval system