KEGG   Polaromonas sp. JS666: Bpro_4176Help
Entry
Bpro_4176         CDS       T00343                                 

Definition
(GenBank) glutathione S-transferase-like protein
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
pol  Polaromonas sp. JS666
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:pol00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Bpro_4176
Enzymes [BR:pol01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Bpro_4176
Transporters [BR:pol02000]
 Other Transporters
  Pores ion channels [TC:1]
   Bpro_4176
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
complement(4391792..4392469)
Genome map
AA seq 225 aa AA seqDB search
MASQLTLISHKLCPYVQRAAIVMAEKCISFERQDIDLAHKPDWFLKVSPLGKTPVLRVDG
EAIFESAVICEYLDETAAPRLHPEGALQRARHRSWMEFGSAILNTIGAFYNAPSEEALAA
RAAELRAKFQLVEAALGSGPYFAGEQFSMVDAVFGPVFRYFDVFDEIGDFGVFADTPKVK
AWRRALAQRESVRNAVRPDYPEFLRAFLRQRESALSRRITVALPA
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atggcctcccaactcacattgatcagccacaagctgtgcccttatgtccagcgcgcggcg
attgtcatggccgagaagtgcattagttttgagcggcaggacattgacctggcccacaag
cccgactggttcctcaaggtctcgccgctgggcaagacgcccgtgctgcgggtggacggc
gaagcgatttttgaatccgccgtcatctgcgaatacctcgacgaaacagccgcaccccgc
ctgcaccccgagggcgccctgcaacgtgcccggcaccgcagctggatggagttcggttct
gcgatcctcaacaccatcggcgccttctataacgcgcccagtgaggaagccctggcggcc
cgcgccgccgagctgcgcgcaaagttccagctggtcgaagcggccctgggaagcggcccc
tacttcgctggcgaacagttcagcatggtggatgcggtcttcggcccggtcttccggtac
ttcgacgtgttcgacgaaatcggtgatttcggtgttttcgccgatacgcccaaggtgaag
gcctggcggcgcgcgctggcacaacgtgaatcggtccgcaacgcggttcgtcctgattac
cctgaatttctgcgcgcctttctgcggcaacgcgagtcggcgctgtcccggcgcataact
gtcgcgctgccagcttga

DBGET integrated database retrieval system