Pongo abelii (Sumatran orangutan): 100174544 Help Entry 100174544         CDS       T01416                                  Symbol GSTP1 Name (RefSeq) glutathione S-transferase P   KO K23790   glutathione S-transferase P [EC:2.5.1.18] Organism pon  Pongo abelii (Sumatran orangutan) Pathway pon00480   Glutathione metabolism pon00980   Metabolism of xenobiotics by cytochrome P450 pon00982   Drug metabolism - cytochrome P450 pon00983   Drug metabolism - other enzymes pon01100   Metabolic pathways pon01524   Platinum drug resistance pon05200   Pathways in cancer pon05204   Chemical carcinogenesis - DNA adducts pon05215   Prostate cancer pon05225   Hepatocellular carcinoma pon05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:pon00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     100174544 (GSTP1)   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     100174544 (GSTP1)    00982 Drug metabolism - cytochrome P450     100174544 (GSTP1)    00983 Drug metabolism - other enzymes     100174544 (GSTP1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100174544 (GSTP1)    05204 Chemical carcinogenesis - DNA adducts     100174544 (GSTP1)   09162 Cancer: specific types    05225 Hepatocellular carcinoma     100174544 (GSTP1)    05215 Prostate cancer     100174544 (GSTP1)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     100174544 (GSTP1)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     100174544 (GSTP1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:pon02000]     100174544 (GSTP1) Enzymes [BR:pon01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      100174544 (GSTP1) Transporters [BR:pon02000]  Other transporters   Pores ion channels [TC:1]    100174544 (GSTP1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  GST_C GST_C_3 GST_N GST_N_2 GST_C_2 Motif Other DBs NCBI-GeneID:  100174544 NCBI-ProteinID:  NP_001127471 UniProt:  Q5R8R5 A0A2J8U0H6 LinkDB All DBs Position 11:complement(6689617..6692493) Genome browser AA seq 210 aa AA seqDB search MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVSMETWQEGSLKASCLYGQLPKFQDGD LTLYQSNTILRHLGRTLGLYGKDQREAALVDMVNDGVEDLRCKYLSLIYTNYEAGKDDYV KALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAY VARLSARPKLKAFLASPEHVNLPINGNGKQ NT seq 633 nt NT seq  +upstreamnt  +downstreamnt atgccgccctacaccgtggtctatttcccagttcgaggccgctgcgcggccctgcgcatg ctgctggcagaccagggccagagctggaaggaggaggtggtgtccatggagacgtggcag gagggctcactcaaagcctcctgcctatacgggcagctccccaagttccaggacggagac ctcaccctgtaccagtccaataccatcctgcgtcacctgggccgcacccttgggctctat gggaaggaccagcgggaggcagccctggtggacatggtgaatgacggcgtggaggacctc cgctgcaaatacctctctctcatctacaccaactatgaggcgggcaaggatgactatgtg aaggcattgcccgggcaactgaagccttttgagaccctgctgtcccagaaccagggaggc aagaccttcattgtgggagaccagatctccttcgctgactacaacctgctggatttgctg ctgatccatgaggtcctggcccctggctgcctggatgcgttccccctgctctcagcgtat gtggcacgcctcagcgcccggcccaagctcaaggccttcctggcctcccctgagcacgtg aacctccccatcaatggcaacgggaaacagtga

DBGET integrated database retrieval system