KEGG   Pongo abelii (Sumatran orangutan): 100452414Help
Entry
100452414         CDS       T01416                                 

Gene name
GPD2
Definition
(RefSeq) glycerol-3-phosphate dehydrogenase, mitochondrial isoform X1
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100452414 (GPD2)
Enzymes [BR:pon01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     100452414 (GPD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 EF-hand_10 RNA_pol_Rpb4 EF-hand_4
Motif
Other DBs
NCBI-GeneID: 100452414
NCBI-ProteinID: XP_024099010
Ensembl: ENSPPYG00000012860
LinkDB All DBs
Position
2B
AA seq 727 aa AA seqDB search
MAFQKAVKGTILVGGGALATVLGLSQFAHYRRKQMNLAYVKAADCISEPVNREPPSREAQ
LLTLQNTSEFDILVIGGGATGSGCALDAVTRGLKTALVERDDFSSGTSSRSTKLIHGGVR
YLQKAIMKLDIEQYRMVKEALHERANLLEIAPHLSAPLPIMLPVYKWWQLPYYWVGIKLY
DLVAGSNCLKSSYVLSKSRALEHFPMLQKDKLVGAIVYYDGQHNDARMNLAIALTAARYG
AATANYMEVVSLLKKTDPQTGKVRVSGARCKDVLTGQEFDVRAKCVINATGPFTDSVRKM
DDKDAAAICQPSAGVHIVMPGYYSPESMGLLDPATSDGRVIFFLPWQKMTIAGTTDTPTD
VTHHPIPSEEDINFILNEVRNYLSCDVEVRRGDVLAAWSGIRPLVTDPKSADTQSISRNH
VVDISESGLITIAGGKWTTYRSMAEDTINAAVKTHNLKAGPSRTVGLFLQGGKDWSPTLY
IRLVQDYGLESEVAQHLAATYGDKAFEVAKMASVTGKRWPIVGVRLVSEFPYIEAEVKYG
IKEYACTAVDMISRRTRLAFLNVQAAEEALPRIVELMGRELNWDDYKKQEQLETARKFLY
YEMGYKSRSEQLTDRSEISLLPSDIDRYKKRFHKFDADQKGFITIVDVQRVLESINVQMD
ENTLHEILNEVDLNKNGQVELNEFLQLMSAIQKGRVSGSRLAILMKTAEENLDRRVPIPV
DRSCGGL
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atggcatttcaaaaggcagtgaaagggacgattcttgttggaggaggtgctcttgcaact
gttttaggactttctcagtttgctcattacagaaggaaacaaatgaacctggcctatgtt
aaagcagcagactgcatttcagaaccagttaacagggagcctccttccagagaagctcag
ctactcactttgcaaaatacatctgaatttgatatccttgttattggaggaggagcaaca
ggaagtggctgtgcactagatgctgtcaccagaggactaaaaacagcccttgtagaaaga
gatgatttctcatcagggaccagcagcagaagcactaaattgatccatggtggtgtgaga
tatctgcagaaggccatcatgaagttggatattgagcagtataggatggtaaaagaagcc
cttcatgagcgtgccaacctgctagaaattgctccccatttatcagctccattgcctata
atgcttccagtttacaagtggtggcagttaccttactactgggtaggaatcaagctgtat
gatttggttgcaggaagcaattgcctgaaaagcagttatgtcctcagcaaatcaagagcc
cttgaacatttcccaatgctccagaaggacaaactggtaggagcaattgtctactatgac
ggacaacataacgatgcacggatgaaccttgccattgctctgactgctgccaggtatggg
gctgccacagccaattacatggaggtagtgagcttgctcaagaagacagacccccagaca
gggaaagtgcgtgtgagcggcgcacggtgcaaggatgtcctcacagggcaggaatttgac
gtgagagccaaatgtgttatcaatgccacgggacctttcacggactctgtgcgcaaaatg
gatgataaagacgcagcagctatctgccagccaagtgctggtgtccatattgtgatgcct
ggttattacagcccagagagcatgggacttcttgacccagcgaccagtgatgggcgagtt
attttcttcttaccctggcaaaaaatgacaatcgctggcactactgatactccaactgat
gttacacaccatccaattccttcagaagaagatatcaacttcattttgaatgaagtgcgt
aattacctgagttgtgatgttgaagtgagaagaggggacgtcctggcagcatggagtgga
atccgtcctcttgttacagaccccaaatctgcagatactcagtctatctcccgaaatcat
gttgttgatatcagtgagagtggccttattactatagcaggtggaaagtggacaacttat
cggtctatggcagaagataccataaatgctgctgtcaaaactcataatttaaaagcagga
ccaagtagaacagttgggcttttccttcaagggggtaaagattggagccccacgctctac
attaggcttgtccaggattatggacttgaaagcgaggtggcacagcatcttgccgccacc
tatggtgataaggcctttgaggtggccaaaatggcaagtgtgactggcaaaaggtggcct
attgttggagtacgtcttgtgtcagaatttccatatattgaagcagaggtgaaatatggg
attaaggagtatgcctgcactgctgtggatatgatttcacgtcgtactcgcctggccttt
ctaaatgtccaggcagcagaggaagccttacccaggattgttgaactgatgggcagggaa
ctgaattgggatgattataagaagcaggaacaacttgaaacagccaggaagtttctatat
tatgaaatgggctataaatctcgatcagaacagttaacagatcgctctgaaattagccta
ctgccttcagacattgacaggtataagaagagatttcataagtttgatgcagaccagaaa
ggctttattaccattgttgatgttcagcgtgtattagagagtatcaatgtccaaatggat
gaaaatacactccatgaaattctgaatgaagttgatttaaataaaaatggacaggttgaa
ctcaatgaatttttgcagctgatgagtgctattcaaaaaggaagggtatctggaagccgg
cttgctatactaatgaaaactgcagaagagaacctcgacagaagagttccaattccagtg
gaccgtagttgtggaggattgtga

DBGET integrated database retrieval system