KEGG   Komagataella phaffii: PAS_chr3_0965Help
Entry
PAS_chr3_0965     CDS       T01092                                 

Definition
(RefSeq) Glutamate decarboxylase, converts glutamate into gamma-aminobutyric acid (GABA)
  KO
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
ppa  Komagataella phaffii
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ppa00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    PAS_chr3_0965
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PAS_chr3_0965
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PAS_chr3_0965
   00430 Taurine and hypotaurine metabolism
    PAS_chr3_0965
Enzymes [BR:ppa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     PAS_chr3_0965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3:1871066..1872736
Genome map
AA seq 556 aa AA seqDB search
MTLSNNTKRRESSITPDQQKLIEKYLEKKNVHHQKKLQHVTHTSTNVNLSSIKWKSLRLE
DCGVSIPDSGLPAKIAYESIHDSLNLDGNPTLNLASFVNTGYINDYSEPLIHENLVKNLA
DNDEYPVMLELHERCLQMLTELWNGDSKKSIGSATTGSSEAIMLGGLAMKKNWQTKRRAA
GKSTEKPNIIMASCCQVALEKFARYFEVDARIISCDNNDYILDYDLIYDACDENTIGIFV
ILGSTYTGAFEDVALVNKILDRVEKEKGFDIPIHVDGASGAFVAPFIYPDLEWDFRVPRV
KSINTSGHKFGLVTAGLGWIVFKDKEWLPKDLVFELRYLGGLEYSFTLNFSRPGHQVIHQ
YFNFVALGKNGYSSIFDTCLTNARLLSSFLEETNYFKVVSNVHRPVEAGTTPHADDHLAF
HPSLPVVSFQFNEEFSKQYPEIPQSIISTLMRNKGWIIPNYPLPRTTKPVKDDEREILRV
VVRYNLTLELLQKLMSDIVSTLTVLTNSCKLIRESLNNDALEDTDIIYDMLLSIALDGSE
NLVKSSIKDHKHAGAC
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgaccctatcaaacaacaccaagagaagagaaagttccattactccagatcaacagaag
cttattgaaaagtacctcgaaaagaagaatgtacatcatcagaagaaactgcagcatgta
acgcacacttctaccaatgtcaacctatcatccatcaaatggaagagtttgcgattggag
gactgcggtgtttcaatccctgattcaggattaccagccaagattgcttatgaatcaatc
cacgatagtttgaacctcgatggaaaccccactttgaacttggcctcgtttgttaacact
ggttacatcaacgattatagtgagccattgattcatgagaacttggtgaaaaacttggct
gacaatgatgagtatccagtcatgctggagttacacgaaagatgtctccaaatgcttact
gaattgtggaacggtgattctaagaagagcattggttctgccactacaggctcttctgaa
gccattatgcttgggggactggctatgaagaaaaattggcaaaccaagaggcgtgctgct
ggtaaaagcaccgagaagcctaacattatcatggcttcctgttgccaagttgcgttagag
aagtttgcccgatactttgaagtagacgctcgtatcatttcgtgtgacaacaatgactac
attctggactatgatttgatatatgatgcttgtgacgagaataccataggtatttttgtt
attcttggatcgacctatactggtgcttttgaggacgttgctttagtcaataaaatttta
gaccgtgttgaaaaggagaagggattcgacattccaatccatgtggacggcgcctccggg
gcttttgttgccccttttatctatccagacctggaatgggattttagagttcctcgtgtc
aaatcaatcaacacttcaggccacaagtttggactcgtcacagcaggtttaggttggatt
gttttcaaagacaaggaatggcttcctaaagaccttgtttttgaattacgctatttgggt
ggtctagaatacagttttactctaaacttctcccgtccgggacaccaagtcatccaccaa
tatttcaattttgtcgctttaggaaagaatggatactcgtctatttttgatacatgctta
acaaatgccaggcttctttcatcctttttggaagagacgaactacttcaaggtggtatcg
aacgttcatcgtcctgtggaagcgggcacaacgcctcacgctgatgatcaccttgctttt
catcccagtttgccagtggtttctttccagttcaacgaagagttttccaagcaatatcct
gaaattcctcaatcaatcatatccactttaatgagaaacaagggttggatcattcctaat
tatcctctgccaagaacaactaaaccagtgaaggatgatgagagagaaattcttcgtgtg
gtggttagatacaacttaaccctagagctacttcagaagctgatgagtgacatagtgtcc
acattaactgttttgactaactcatgcaagttgattagagagtctttgaataacgatgct
ttggaggatacagacattatttacgatatgcttctaagtattgctttggacggtagcgag
aatttggtcaagtcgtcaatcaaagatcataaacacgcgggagcttgttaa

DBGET integrated database retrieval system