KEGG   Komagataella phaffii: PAS_chr3_1133Help
Entry
PAS_chr3_1133     CDS       T01092                                 

Definition
(RefSeq) Nucleosomal histone H3-Lys79 methylase, associates with transcriptionally active genes
  KO
K11427  
histone-lysine N-methyltransferase, H3 lysine-79 specific [EC:2.1.1.43]
Organism
ppa  Komagataella phaffii
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:ppa00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    PAS_chr3_1133
Enzymes [BR:ppa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     PAS_chr3_1133
Chromosome [BR:ppa03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     PAS_chr3_1133
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3:2184251..2186233
Genome map
AA seq 660 aa AA seqDB search
MGGTKIEDENNACCLSKELDINPLWQTDETSRDELVQEALLLESKSGSKPAHIAQLLDDS
EWYRPSSFNESTVSPRPYNKSNHSAISTCKEGKSIETQGCQTNFKTAPSSTSCISKTKGA
TKATKILTDKRSASPKALGMTREMKDLWAGAAWHLRDNPEYFSSKHQRKRLTQPNNRCNF
HDSQTSQETHTGSKKAKKESERPRKEQIKAKSKEVCLKIKNNELPQVETQFESPDKQPTL
EEPSKRFQNKIWFIEYDPHNESQSVLVGNRKFFVDEIYEKQESPVTISNAKSAFALVNET
KNRYWNDENLPPTAVYLSMPVSSYREKYQLIFPKDEELNPFEEIGRMMEISALFYLPLKY
ASLVRNEDSFANCIVGQFIKAYERSHYEVILKKIEEYNILIDSLRSSGVIYDHIRAQTKV
PRPMIYEILNQVYARTVSPNSKKLRQYKAFSNYVYGELLPNFLTQAFNEVKLDSSSKFID
LGSGVGNCVFQAALEYGCESFGCEIMEHASFLSELQLIEFKTRCDIFGIKPGKVEFFLRQ
TFEDNLQVSEVVSKCEVILVNNYLFDATLNSKVISLFQCLKESIGTKIVSLKPVIPLNYT
IHDDLTLTNVLSFMKTKRSVYSENSVSWTCKGGVYYLTEVVADVPIELMGSSTRQSKSHN
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgggtggaacaaagatagaggacgaaaataatgcatgctgcctctcaaaagaacttgat
atcaaccctttgtggcagacagatgagacttctcgggatgagctagttcaagaagcccta
cttttagaaagcaaatctggatctaagcctgcccacatagctcagcttctagacgattca
gaatggtacaggccatcttcgttcaacgaaagtactgtatctcctaggccgtataataaa
tccaatcattcggcaattagtacgtgcaaagaaggcaaatcgattgagactcaaggttgc
caaacgaattttaagacagctccttcctcgacaagttgtatttcaaaaacaaagggagct
acgaaggctacaaaaatcttgaccgataaaagatcagcttcaccaaaggctctgggtatg
actagggaaatgaaagacctatgggcaggggctgcttggcatttaagggataatcctgag
tacttttcttccaagcatcaaaggaagaggttaactcaacccaacaaccgttgcaacttt
cacgattctcaaacatcgcaggaaactcatacaggttcgaagaaagctaagaaggaatct
gagagaccaagaaaagaacaaattaaagccaaatctaaagaggtatgcttaaaaattaag
aataacgagttacctcaagttgaaactcaatttgaaagtcctgacaaacagcccaccttg
gaagagccttcaaaaaggtttcaaaacaagatttggttcattgaatacgatcctcacaat
gaaagtcaaagtgttttagtaggaaacaggaagtttttcgtagacgagatctatgagaaa
caggaatctcctgtaactatctctaatgccaaatctgcatttgctctagtgaacgaaacc
aaaaaccgatactggaacgatgaaaatttacccccaactgcagtttatttatcgatgcct
gtttcttcctatagggaaaaatatcagcttatttttccaaaggacgaagaactaaatcct
ttcgaagaaattggtcgaatgatggagatttccgcattgttttatctccccttgaagtat
gcctcccttgttcgcaatgaagattcctttgcgaattgcatcgttggacagtttattaag
gcatacgagagatcgcattacgaggtcatcttgaagaaaattgaagagtacaacatactc
attgatagtttacgaagttctggtgtcatatatgatcatataagagcccagacaaaagta
ccccggcctatgatttatgagattcttaatcaagtttatgcccgcactgtgtctccaaat
tcgaaaaagctccgtcagtacaaggcgttctcaaattatgtttatggagaattacttcca
aactttttaacgcaagcctttaatgaagtgaaacttgattcaagttccaagttcatagat
ctaggttctggtgtcggaaactgcgtctttcaggctgctcttgagtatgggtgtgaaagt
ttcggctgcgaaattatggaacatgcttctttcctcagtgagttacagttgattgagttc
aaaactagatgcgatatctttggaatcaagcctgggaaagttgagttttttctgagacaa
acctttgaagataatctacaggtttcggaagtggtttccaaatgtgaagtaatactggtg
aacaattacctctttgacgccactttgaactcgaaagtcatttctcttttccagtgtctc
aaagaaagtatcgggacaaaaatagtcagtcttaagccagtgattcctctcaactatacc
attcacgatgaccttactttgaccaatgttttatcctttatgaaaactaagagaagtgtc
tacagcgaaaatagtgtttcttggacctgtaaaggaggcgtttactacctaacagaagtt
gttgccgatgttccaatagaattaatgggcagctccacgaggcaatctaagtcacacaat
tga

DBGET integrated database retrieval system