KEGG   Palaeococcus pacificus: PAP_00275Help
Entry
PAP_00275         CDS       T03210                                 

Definition
(GenBank) alpha-amylase
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
ppac  Palaeococcus pacificus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppac00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PAP_00275
Enzymes [BR:ppac01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     PAP_00275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(50288..51670)
Genome map
AA seq 460 aa AA seqDB search
MRTGLKKVLAIFGLLLIVLSFTAEQAIALSPEEGGVMMQAFYWDVPEGGIWYDTIRAKIP
DWAAAGITSIWLPPPSKGMSGGYSMGYDPYDYFDLGEYYQMGTVETRFGSKQELIDLINT
AHSYGLEVYADIVINHRAGGDLEWNPFVNDYTWTDFSKVASGKYTANYLDFHPNELHASD
AGAFGGYPDICHDKSWDQYWLWASSESYAAYLKSVGFDGWRFDYVKGYDPWVVKDWLSWW
GGYAVGEYWDTNVNLVLDWIRGSGANAFDFALYYKMDEAFDNTNIPALVSAIQNGQVLVA
VDPFDAVTFVANHDTDIIWNKYPAYAFILTYEGQPTIFYRDYEEWLNKDRLTNLIWIHNN
LAGGTTEIVYYDSDELIFVRNGYGSKPGLITYINLGSGWAGRWVYVPKFAGSTIHEYTGN
LGGWVDKWVDSNGWVYLEAPPHDPANGYYGYSVWSYAGIG
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
gtgcggacaggtcttaaaaaagttctggccatttttggcctgctcttgatagtgctatca
ttcacagcagagcaagcaatagcactatccccagaagaaggcggagtaatgatgcaagcg
ttctactgggacgttccggagggtggaatatggtacgacacaataagggccaaaattccc
gattgggctgctgctggaataacttccatctggctcccgccgccatccaagggcatgagc
ggaggctattcgatgggttatgatccctacgactactttgacctcggcgaatactatcag
atgggaacggtagagactcgcttcggttcaaagcaagagttaatagacctcataaacact
gcccactcctatgggcttgaggtctacgccgacatagtaataaaccaccgcgccggcggc
gatttggagtggaacccctttgtgaacgactacacatggacggacttttctaaagttgcc
tcgggcaagtacaccgccaactacctcgacttccatcccaacgagcttcacgccagtgat
gctggagctttcggcggctatccggatatatgccacgacaagagctgggatcagtactgg
ctctgggcgagcagtgagagctatgcggcatatcttaaaagcgtcggcttcgatgggtgg
cgcttcgattacgtcaagggctatgacccgtgggtcgtgaaggactggctcagctggtgg
ggcggctatgcagtcggagagtactgggacaccaacgtaaacctcgtcttggactggata
agaggaagcggggccaatgcttttgacttcgcgctctactacaagatggatgaggccttt
gacaacactaacatccccgcactcgtctccgccatacagaacggacaggttttagttgcg
gttgatcccttcgatgcggtaacctttgtggcaaatcacgacacggacataatatggaac
aagtacccagcatacgcattcattctcacctatgagggacaaccaacgatattttaccgg
gactacgaagagtggctcaacaaggacaggctcaccaacttaatctggatacacaacaac
ctggcgggcggaaccacggaaatagtttactacgacagcgatgagcttatctttgtgagg
aatggctatggaagcaagcccggactgataacatacatcaatctcggaagcggctgggca
ggaaggtgggtctatgttccgaagttcgccggttcaacgatacatgaatacaccggcaac
ctcgggggatgggtcgataagtgggtcgattcaaacggatgggtatatcttgaggcgcca
cctcacgatccggccaatggttattatggctactccgtctggagctacgcggggattggc
tga

DBGET integrated database retrieval system