Panthera pardus (leopard): 109249683 Help Entry 109249683         CDS       T06062                                  Symbol SOD1 Name (RefSeq) superoxide dismutase [Cu-Zn]   KO K04565   superoxide dismutase, Cu-Zn family [EC:1.15.1.1] Organism ppad  Panthera pardus (leopard) Pathway ppad04146   Peroxisome ppad04213   Longevity regulating pathway - multiple species ppad05012   Parkinson disease ppad05014   Amyotrophic lateral sclerosis ppad05016   Huntington disease ppad05020   Prion disease ppad05022   Pathways of neurodegeneration - multiple diseases ppad05208   Chemical carcinogenesis - reactive oxygen species Brite KEGG Orthology (KO) [BR:ppad00001]  09140 Cellular Processes   09141 Transport and catabolism    04146 Peroxisome     109249683 (SOD1)  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     109249683 (SOD1)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     109249683 (SOD1)   09164 Neurodegenerative disease    05012 Parkinson disease     109249683 (SOD1)    05014 Amyotrophic lateral sclerosis     109249683 (SOD1)    05016 Huntington disease     109249683 (SOD1)    05020 Prion disease     109249683 (SOD1)    05022 Pathways of neurodegeneration - multiple diseases     109249683 (SOD1) Enzymes [BR:ppad01000]  1. Oxidoreductases   1.15  Acting on superoxide as acceptor    1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)     1.15.1.1  superoxide dismutase      109249683 (SOD1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Sod_Cu Motif Other DBs NCBI-GeneID:  109249683 NCBI-ProteinID:  XP_019275720 Ensembl:  ENSPPRG00000001437 UniProt:  A0A9V1E7L5 LinkDB All DBs Position Unknown AA seq 153 aa AA seqDB search MEMKAVCVLKGQGPVEGTIHFVQKGNGPVVVSGTIRGLTEGEHGFHVHQFGDNTQGCTSA GPHFNPLSKKHGGPKDEERHVGDLGNVTAGKDGVANVSMEDSLIALSGDHSIIGRTMVVH EKRDDLGKGGNEESTQTGNAGSRLACGVIGIAK NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atggagatgaaggccgtgtgcgtgctgaagggccagggcccggtggagggcaccatccac ttcgtacagaagggcaatgggcctgttgtggtatcaggaaccattagaggattgactgaa ggcgagcatggattccacgtccatcagtttggagataatacacaaggctgtaccagtgca ggccctcactttaatcctctatccaaaaaacacggtgggccaaaagatgaagagaggcat gttggagaccttggcaacgtaactgctggcaaggacggtgtggccaacgtgtctatggaa gattctctgattgcactctcaggagaccattccatcattggccgcacgatggtggtccac gagaaacgagatgacttgggcaaaggtggaaatgaagaaagtacgcaaacgggaaacgct gggagtcgtttggcttgtggtgtcattgggatcgccaagtaa

DBGET integrated database retrieval system