Panthera pardus (leopard): 109252583 Help Entry 109252583         CDS       T06062                                  Name (RefSeq) histone H3.1   KO K11253   histone H3 Organism ppad  Panthera pardus (leopard) Pathway ppad04613   Neutrophil extracellular trap formation ppad05034   Alcoholism ppad05202   Transcriptional misregulation in cancer ppad05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:ppad00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     109252583  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     109252583   09163 Immune disease    05322 Systemic lupus erythematosus     109252583   09165 Substance dependence    05034 Alcoholism     109252583  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ppad03036]     109252583   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ppad04147]     109252583 Chromosome and associated proteins [BR:ppad03036]  Eukaryotic type   Nucleosome assembly factors    Histones     109252583 Exosome [BR:ppad04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    109252583 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-S CENP-T_C CBFD_NFYB_HMF PAF YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  109252583 NCBI-ProteinID:  XP_019280713 Ensembl:  ENSPPRG00000014535 UniProt:  A0A9V1EFR5 LinkDB All DBs Position Unknown AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgcacgaagcagacagcgcgcaagtcgacgggcggcaaggccccgcgcaagcag ctggccaccaaggcggcccgcaagagcgcgccggccaccggcggcgtcaagaagccgcac cgctaccggcccggcacggtggccctgcgcgagatccgccgctaccagaagtccaccgag ctgctgatccgcaagctgccgttccagcggctggtgcgcgagatcgcgcaggacttcaag accgacctgcgcttccagagctcggccgtgatggcgctgcaggaggcgtgcgaggcctac ctggtggggctcttcgaggacaccaacctgtgcgccatccacgccaagcgcgtcaccatc atgcccaaggacatccagctggcgcgccgcatccgcggggagcgggcgtaa

DBGET integrated database retrieval system