KEGG   Pseudomonas putida BIRD-1: PPUBIRD1_4054Help
Entry
PPUBIRD1_4054     CDS       T01975                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ppb  Pseudomonas putida BIRD-1
Pathway
ppb00620  Pyruvate metabolism
ppb00680  Methane metabolism
ppb01100  Metabolic pathways
ppb01120  Microbial metabolism in diverse environments
ppb01200  Carbon metabolism
Module
ppb_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:ppb00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PPUBIRD1_4054
  Energy metabolism
   00680 Methane metabolism
    PPUBIRD1_4054
Enzymes [BR:ppb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     PPUBIRD1_4054
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ADR61636
LinkDB All DBs
Position
complement(4534092..4536719)
Genome map
AA seq 875 aa AA seqDB search
MTDIDVRLREDVHVLGELLGETIRQQHGDAFLQKIEDIRHSAKADRRGPGEQLSSTLADL
AEEDLLPVARAFNQFLNLANMAEQYQLIRRRNADQPEPFEAQVLPELLGRLKQAGHSNDA
LARQLAKLDIQLVLTAHPTEVARRTLIQKYDAIAGQLAAQDHRDLTSAERQQVRERLRRL
IAEAWHTEEIRRTRPTPVDEAKWGFAVIEHSLWHAIPSHLRKVDKALLEATGLRLPLEAA
PIRFASWMGGDRDGNPNVTAAVTREVLLLARWMAADLFLRDIDALAAELSMQQANDALRK
QVGDSAEPYRAVLKRLRDRLRATRAWAHSALTSNQPADADVLVDNRELIAPLELCYQSLH
ECGMGVIAEGPLLDCLRRAVTFGLFLGRLDVRQDAARHRDALTEITDYLGLGRYADWDEE
QRIAFLQAELKNRRPLLPAHFKPQADTAEVLATCREVAAAPAASLGSYVISMAGAASDVL
AVQLLLKEAGLTRPMRVVPLFETLADLDNAGPVMQRLLGLPGYRAGLRGPQEVMIGYSDS
AKDAGTTAAAWAQYRAQENLVRICAEHQVELLLFHGRGGTVGRGGGPAHAAILSQPPGSV
AGRLRTTEQGEMIRFKFGLPGIAEQNLNLYLAAVLEATLLPPPPPQPAWREVMDQLAADG
VQAYRRVVRENPDFVEYFRQSTPEQELGRLPLGSRPAKRRAGGIESLRAIPWIFGWTQTR
LMLPAWLGWETALTNALARGQGELLAQMREQWPFFRTRIDMLEMVLAKADAQIAEAYDER
LVQPHLRPLGAHLRDLLSQSCQVVLGLTGQPVLLAHSPETLEFISLRNTYLDPLHRLQAE
LLARSRSREAALDSPLEQALLVTVAGIAAGLRNTG
NT seq 2628 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatatcgatgtgcgtttgcgtgaagatgtccatgtgttgggtgaactgcttggc
gaaaccattcgccagcagcatggcgatgcgttcctgcagaaaatcgaggacatccgccac
agtgccaaggccgaccgtcgcggcccgggtgagcagttgagctcgaccctggcagacctg
gccgaagaagatctgctgcccgtagcgagggccttcaaccagttcctcaacctggccaac
atggccgagcagtaccagttgatccgccgccgcaacgccgaccagcccgagccgttcgaa
gcgcaggtactgcccgagctgctggggcgcttgaagcaggccggccacagcaacgatgcc
ctggcccggcaactggccaagctcgatatccagttggtgctcaccgcacatcccaccgaa
gttgcccgtcgcacgctgatccagaagtacgacgcaatcgccggccaactggccgcgcag
gaccatcgtgacctgacctcggcagaacgccagcaagtgcgcgaacgcctgcgccggctg
atcgccgaggcctggcacaccgaagaaatccgccgtacccggcctacgccggtagacgaa
gccaagtggggtttcgcagtgatcgagcattcactgtggcatgccatccccagccacctg
cgcaaggtcgacaaggccctgctggaggccactggcctgcgcctgccgctggaggccgcg
ccgattcgctttgcctcgtggatgggtggggaccgtgatggcaaccccaatgtgacggct
gcggtcacccgcgaagtactcctgctggcgcgctggatggccgccgacctgttcctgcgc
gacatcgatgcactggccgccgagttgtccatgcagcaggccaacgacgccctgcgcaaa
caggttggcgacagtgccgaaccctaccgcgctgtgctcaagcgactgcgcgaccgcctg
cgtgcgacacgcgcatgggcgcattcggccttgaccagcaaccaaccggccgatgccgac
gtgctggtagacaaccgcgagctgatcgcgccgctggagctgtgctaccagtcactgcac
gaatgcggcatgggcgtgatcgccgaggggccgctgctcgactgcttgcgtcgtgcggtg
accttcggcctgttcctgggccgcctggacgtacgccaggatgctgctcgtcaccgtgat
gcgctgaccgagattaccgattacctgggcctggggcgttacgccgactgggatgaggag
cagcgcatcgcgttcctccaggccgagctgaaaaaccgccggcccctgctgcctgcgcat
ttcaagccgcaagcggacaccgccgaagtgctggcgacctgcagggaagtggccgctgcg
ccggccgcctcgctggggtcttacgtgatctccatggccggtgccgcctcggatgtactg
gcggtgcaactgttgctcaaggaagccggcctgacccgccccatgcgtgtggtgccactg
ttcgagaccctggccgacctcgacaacgccggcccggtcatgcagcgcctgcttggcctg
ccgggctaccgcgcgggcctgcgcggcccgcaggaggtgatgatcggctactccgattcg
gccaaggacgccggcaccacggccgctgcctgggcgcagtaccgggctcaggagaacctg
gtgcgtatctgtgccgagcatcaggtcgagctgctgctgttccacggccgtggcggtacg
gtcgggcgaggcggtggcccggcccatgcggcgatcctgtcgcagccaccgggttcggtg
gcggggcgtttgcgcaccaccgagcagggtgaaatgatccgcttcaagttcggcttgccg
ggcatcgccgagcaaaacctcaacctgtacttggccgccgtgcttgaagcgacgttgttg
ccaccaccacccccgcagccggcctggcgtgaggtgatggaccagttggccgccgatggt
gtccaggcttaccgccgcgtggtacgggagaatcccgatttcgtcgagtacttccgccag
tcgacgccagaacaggaactggggcgcctgccgttgggcagccgcccggcaaaacgtcgc
gccgggggcatcgaaagcctgcgggccatcccgtggatcttcggctggacccagacccgg
ctgatgctgccggcctggctgggctgggaaacggcgctgaccaatgccttggcccgtggt
cagggagagttgctggcgcagatgcgcgagcaatggccgttcttccgcacccgcatcgac
atgctggaaatggtgctggccaaggccgatgcgcaaattgccgaggcctacgacgaacgt
ctggtgcaaccacacctgcgtcctttaggtgcgcacctgcgcgacctattgtcgcagtca
tgccaggtggtgctgggcctgaccgggcagccggtgctactggcgcacagccccgagacg
ctggaattcattagcctgcgcaatacctatctggacccgttgcaccgtctgcaggcagag
ttgctggctcgctcgcgcagccgcgaagccgctctggacagcccgttggagcaggccttg
ctggtgactgtggcgggtattgccgccgggctgcgcaacaccggctaa

DBGET integrated database retrieval system