KEGG   Pseudopropionibacterium propionicum: HMPREF9154_2502Help
Entry
HMPREF9154_2502   CDS       T02180                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
ppc  Pseudopropionibacterium propionicum
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Quorum sensing
Brite
KEGG Orthology (KO) [BR:ppc00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    HMPREF9154_2502
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    HMPREF9154_2502
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    HMPREF9154_2502
   00430 Taurine and hypotaurine metabolism
    HMPREF9154_2502
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    HMPREF9154_2502
Enzymes [BR:ppc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     HMPREF9154_2502
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2702289..2703764
Genome map
AA seq 491 aa AA seqDB search
MRQDRFIPGACEGQAPSPERIEVAMSPSHPHRTASAGTRQVELNPLFARPGEATELPRTR
LPRGESLPETAYQIVHDEAMLDGNARLNLATFVGTWMDDHANRLALESADKNMIDKDEYP
RTAEIETRCWQMLADLWHSPDPEHTIGTSTIGSSEAAMLGGLALKRRWQQARRAAGKSAD
RPNLVMSSAVQVCWEKFCNYWDVEARYVPVSREHPIFDGHDLEHYVDENTIGVVAIMGIT
YTGRYEPVAGIAAALDRIQAETGLDVRIHVDGASGAMVAPFLQPDLEWDFRLERVVSINT
SGHKYGLVYPGLGWVVWRTADDLPEDLVFRVSYLGGDMPTFALNFSRPGSQVLLQYYLFL
RLGFDGYRRVHETSRSVATFLSGEIGAMDDFELCSDGTDIPVFAWRLTQRPGRNWGLHDL
SDRLRMKGWLVPTYPLPNDLADELVQRVVVRNGFSHDLAHAFLDDLRCEVDHLNTLTAPM
PAITRQSGFHH
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
gtgaggcaggatcggttcatccccggagcatgcgagggtcaggcaccctcgccggaacga
atcgaggtggccatgagcccgtcacacccccaccgcaccgcatccgccggcacgcgccag
gtggagttgaatcccctcttcgcccggccaggtgaggccaccgagctgccgcgcacccgc
ctgccccgaggcgaatcgctgccggaaaccgcctaccagatcgtccacgacgaggcgatg
ctcgacggcaacgcccgcctcaacctggccaccttcgtcggcacctggatggacgatcac
gccaaccgcctggcgttggagtcggcggacaagaacatgatcgacaaggacgagtacccc
cgcaccgcggagatcgaaacccgctgctggcagatgctcgccgacctgtggcactccccc
gacccggaacacacgatcggcacctcgacgatcggatcgtcggaggcggcgatgctgggc
ggcctggcgttgaagcgtcgctggcagcaggcccgccgcgccgccgggaaatccgcggac
cgccccaacctggtgatgtccagcgccgtgcaggtgtgctgggagaagttctgcaactac
tgggacgtggaggcgcgctacgtgccggtcagccgggaacatccgatattcgacggccac
gacctggaacactacgtcgacgagaacaccatcggtgtggtcgcgatcatgggaatcacc
tacacgggacgctacgaaccggtcgccgggatcgcggccgccctggaccgcatccaggcc
gaaaccggactcgacgtcaggatccacgtcgacggtgcgtcgggggcaatggtggcgccc
ttcctgcaaccggacctggaatgggacttccggctggaacgggtggtctccatcaacacc
tcgggacacaagtacgggctcgtgtacccgggtctggggtgggtggtgtggcgcaccgcc
gacgacctgcccgaggatctggtgttccgggtcagctacctgggaggcgacatgccgacc
ttcgcgctgaacttctcccgccccggatcgcaggtgctgctgcagtactacttgttcctg
cggctcggtttcgacgggtaccggcgcgtccacgagacgtcgcggtcggtcgccactttc
ctgtcgggcgagatcggcgccatggacgacttcgaactgtgcagcgacggcaccgacatt
cccgtcttcgcctggcgcctcacgcaacgccccggccgcaactggggcctgcacgacctc
tccgaccggctgcgaatgaagggctggctggtgcccacctaccccctgcccaatgacctg
gccgacgaactggtgcagcgcgtcgtggtccgcaacggtttcagccacgacctggcccac
gccttcctcgacgacctgcgctgcgaggtcgaccacctgaacaccctgacagcccccatg
ccggcgatcaccaggcagtccggtttccaccactga

DBGET integrated database retrieval system