KEGG   Pediococcus pentosaceus SL4: T256_06570Help
Entry
T256_06570        CDS       T02906                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
ppen  Pediococcus pentosaceus SL4
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppen00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    T256_06570
Enzymes [BR:ppen01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     T256_06570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(1284441..1285034)
Genome map
AA seq 197 aa AA seqDB search
MAQLFFHYGAMNSGKSIEILKVAHNYEEQDKKVILMTSGIDTRTAVGEISSRIGLRRDAL
PIFDDTNVLELITQASAQEDTACILIDEAQFLKKHHIIELAKVVDDLGIPVMTFGLKNDF
RNELFEGTKYLLLYADKIVEMKTICWFCKHKALMNLRVHDGKPVYDGEQVQIGGNESYYP
VCRRHYFHPLTEEEMRN
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atggcacagttattttttcattacggagcaatgaatagtggtaagtcaattgaaatttta
aaagtggctcataactatgaagaacaagataaaaaagttattttaatgacgagtggtatt
gatactagaacggctgttggtgaaatttccagccggattgggttgcgccgagatgctctt
ccaatttttgatgatacgaatgttttggaattgattacgcaagctagtgcccaagaagat
actgcttgtatcttgattgatgaagctcaatttttgaaaaaacatcacattatagaacta
gctaaagtagtcgatgacttaggaattccagtcatgacgtttggtttaaaaaatgatttc
agaaatgaattgtttgaaggaactaaatacttacttttatatgccgataaaattgtggaa
atgaagacaatttgttggttctgtaagcacaaagcgctaatgaatttacgcgttcatgat
ggtaaaccggtctatgatggtgagcaagttcaaattggtggtaatgagtcttattacccg
gtttgtcgtcgccattattttcacccactgactgaagaagaaatgaggaattaa

DBGET integrated database retrieval system