KEGG   Paenibacillus peoriae: ABE82_08445Help
Entry
ABE82_08445       CDS       T04053                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
ppeo  Paenibacillus peoriae
Pathway
ppeo00020  Citrate cycle (TCA cycle)
ppeo00480  Glutathione metabolism
ppeo01100  Metabolic pathways
ppeo01110  Biosynthesis of secondary metabolites
ppeo01120  Microbial metabolism in diverse environments
ppeo01130  Biosynthesis of antibiotics
ppeo01200  Carbon metabolism
ppeo01210  2-Oxocarboxylic acid metabolism
ppeo01230  Biosynthesis of amino acids
Module
ppeo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ppeo_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:ppeo00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ABE82_08445
  Metabolism of other amino acids
   00480 Glutathione metabolism
    ABE82_08445
Enzymes [BR:ppeo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     ABE82_08445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ALA41546
UniProt: A0A0K2F6X8
LinkDB All DBs
Position
1908271..1909566
Genome map
AA seq 431 aa AA seqDB search
MAKFEKFELPTEGEKITIDNGQLQVPNHPVIPFIEGDGTGRDIWKASKRVLDAAVEKAYN
GSKKIAWYEVFAGEKAFNTYGEWLPNDTLEAIREYIVAIKGPLTTPIGGGIRSLNVALRQ
ELDLYVCLRPVRYFNGVPSPVKRPELVDMVIFRENTEDIYAGIEYAEGSEDVKKVIQFLQ
QELGVNKIRFPETSGIGIKPVSSEGSKRLVRAAIQYAVDHGRKSVTLVHKGNIMKFTEGA
FKNWGYEVAEEEFADKVFTWAQYDVIKEKDGEDAANAAQKAAEDAGKIIIKDAIADIALQ
QVLTRPSEFDVIATLNLNGDYLSDALAAQVGGIGIAPGANINYVTGHAIFEATHGTAPKY
ADKDVVNPGSVILSGVMLLEHLGWQEAADLIYKGLETSINKKIVTYDFARLMDGATQVKC
SEFADTIISNL
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaatttgaaaagtttgagctcccaactgaaggcgaaaaaattacgattgataac
ggtcaactacaggttccgaaccatccggtaattccgtttatcgaaggtgacggcacgggt
cgcgacatctggaaagcttccaaacgcgtactggacgcagctgtagaaaaagcatataac
ggcagcaaaaagattgcctggtatgaagtattcgctggtgagaaagctttcaatacatac
ggcgaatggctccctaacgatactttggaagccatccgtgagtatattgtagccatcaaa
ggaccacttacgacacctattggcggtggtattcgttcgttgaatgtggcattgcgtcaa
gaactggatttatacgtatgtctgcgtcctgttcgttattttaacggtgttccttctcca
gtgaaacgtcctgaattggtagacatggttattttccgtgagaacacagaagatatttac
gcggggatcgagtatgctgaagggtccgaagacgtgaaaaaggttattcagttcctccaa
caagagctgggtgtgaacaaaatccgtttccctgaaacctctggtattggcattaagcca
gtttcttccgagggttcaaagcgtctggtgcgggctgccattcagtatgctgttgaccac
ggacgcaagagtgtaacgctcgtacacaaaggtaacattatgaaatttaccgagggtgcc
ttcaaaaactggggttatgaagtggctgaggaagaatttgcagataaagtatttacttgg
gcccaatatgatgtaatcaaggaaaaagacggtgaggatgcggcgaatgcagctcaaaaa
gcagctgaagatgcaggcaaaatcattatcaaggatgcgattgctgatattgcacttcag
caagtactgactcgtccttctgaatttgatgtgattgctacgctcaacctgaacggggac
tatctgtccgatgctcttgctgcccaagttggtggaattggtattgcgccaggtgcgaac
attaactatgtaacagggcatgctatctttgaagctacacatggtacagctccaaaatac
gccgacaaagacgtagtgaaccctggttccgtaattctgtcgggcgtaatgttgcttgaa
cacttgggttggcaagaagcggctgacctgatttacaaagggctggagacgtccattaat
aagaagattgtaacttatgactttgctcgtctgatggatggtgctacacaagtgaaatgc
tccgagttcgcagataccattattagtaacctgtaa

DBGET integrated database retrieval system