KEGG   Prunus persica (peach): 9978733Help
Entry
9978733           CDS       T03092                                 

Gene name
rbcL, PrpeC_p029
Definition
(RefSeq) ribulose 1,5-bisphosphate carboxylase/oxygenase large subunit
  KO
K01601  
ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
pper  Prunus persica (peach)
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Photorespiration
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:pper00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    9978733 (rbcL)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    9978733 (rbcL)
Enzymes [BR:pper01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     9978733 (rbcL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
CP
AA seq 475 aa AA seqDB search
MSPQTETKASVGFKAGVKDYKLTYYTPDYETKDTDILAAFRVTPQPGVPPEEAGAAVAAE
SSTGTWTTVWTDGLTSLDRYKGRCYHIEPVAGEESQFIAYVAYPLDLFEEGSVTNMFTSI
VGNVFGFKALRALRLEDLRIPPAYVKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGL
SAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFCAEAIYKAQAETGEIKGHYL
NATAGTCEEMIKRAVFARELGVPIVMHDYLTGGFTANTSLAHYCRDNGLLLHIHRAMHAV
IDRQKNHGMHFRVLAKALRMSGGDHIHAGTVVGKLEGEREITLGFVDLLRDDFVEKDRSR
GIYFTQDWVSLPGVLPVASGGIHVWHMPALTEIFGDDSVLQFGGGTLGHPWGNAPGAVAN
RVALEACVQARNEGRDLAREGNEIIREASKWSPELAAACEIWKEIKFEFQAMDTL
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgtcaccacaaacagagactaaagcaagtgttggattcaaagctggtgttaaagattat
aaattgacttattatactcctgactatgaaaccaaagatactgatatcttggcagcattt
cgagtaactcctcaacctggagttccacctgaagaagcaggggcagcggtagctgctgaa
tcttctactggtacatggacaactgtatggactgacgggcttactagtcttgatcgttac
aaaggtcgatgctaccacatcgagcccgttgctggagaagaaagtcaatttattgcttat
gtagcttaccccttagacctttttgaagagggttctgttactaacatgtttacttccatt
gtaggtaatgtgtttgggttcaaggccctgcgcgctctacgtctggaggatttgcgaatc
cctcctgcttatgttaaaactttccaaggcccgcctcatgggatccaagttgagagagat
aaattgaacaagtatggccgccccctattgggatgtactattaaacctaaattggggtta
tccgctaagaattacggtagagcagtttatgaatgtctccgcggtggacttgattttacc
aaagatgatgagaatgttaattcccaaccatttatgcgttggagagaccgtttcttattt
tgtgccgaagcaatttataaagcacaggctgaaacaggtgaaatcaaagggcattacttg
aacgctactgcaggtacatgcgaagagatgatcaaaagagctgtatttgccagagaattg
ggggttcctatcgtaatgcatgattacttaacagggggattcactgcaaatactagcttg
gctcattattgccgagataatggtttacttcttcacatccaccgtgcaatgcatgcagtt
attgatagacagaagaatcatggtatgcactttcgtgtactagctaaagcgttacgtatg
tctggtggagatcatatacacgctggtaccgtagtaggtaaacttgagggggaaagggag
atcactttaggctttgttgatttactacgtgatgattttgttgaaaaagatcgaagccgc
ggtatttatttcactcaagattgggtctctttgccaggtgttttgcctgtagcttcaggg
ggtattcacgtttggcatatgcctgctctgaccgagatctttggagatgattctgtacta
caatttggcggcggaactttaggacacccttggggaaatgcacctggtgccgtagctaat
cgagtagctctagaagcatgtgtacaagctcgtaatgagggacgtgatcttgctcgtgag
ggtaatgaaattattcgcgaggctagtaaatggagtcctgaactagctgctgcttgtgaa
atatggaaggagatcaaatttgaattccaagcaatggatactttgtaa

DBGET integrated database retrieval system