KEGG   Pseudomonas putida F1: Pput_1784Help
Entry
Pput_1784         CDS       T00537                                 

Definition
(GenBank) trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
ppf  Pseudomonas putida F1
Pathway
ppf00500  Starch and sucrose metabolism
ppf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppf00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Pput_1784
Enzymes [BR:ppf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Pput_1784
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     Pput_1784
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C Apolipoprotein
Motif
Other DBs
NCBI-ProteinID: ABQ77937
JGI: Pput1784
UniProt: A5W1C7
LinkDB All DBs
Position
2040179..2043499
Genome map
AA seq 1106 aa AA seqDB search
MAKRSRPAAFIDDPLWYKDAVIYQLHIKSFFDSNNDGIGDFAGLISKLDYIAELGVNTLW
LLPFYPSPRRDDGYDIAEYKAVHPDYGSMADARRFIAEAHKRGLRVITELVINHTSDQHP
WFQRARHAKRGSKAREFYVWSDDDQKYDGTRIIFLDTEKSNWTWDPVAGQYFWHRFYSHQ
PDLNFDNPQVLKAVIGVMRFWLDLGVDGLRLDAIPYLIERDGTNNENLAETHDVLKAIRA
EIDANYPDRMLLAEANQWPEDTRPYFGEGDGDECHMAFHFPLMPRMYMALAMEDRFPITD
ILRQTPEIPANCQWAIFLRNHDELTLEMVTDRERDYLWNYYAEDRRARINLGIRRRLAPL
LQRDRRRIELLTSLLLSMPGTPTLYYGDELGMGDNIYLGDRDGVRTPMQWSPDRNGGFSR
ADPQRLVLPPIMDPLYGYQTVNVEAQSHDPHSLLNWTRRMLAVRKQQKAFGRGSLRTLTP
SNRRILAYIREYTDADGNTEVILCVANVSRAAQAAELELSQYADKVPVEMLGGSAFPPIG
QLPFLLTLPPYAFYWFLLASRDRMPSWHIQPTEGLPELTTLVLRKRMEELLQAPASDTLQ
STILPQYLPKRRWFAGKEGPIDAVRLCYGVRFGTATTPVLLSEIEVLSDGTATCYQLPFG
LLREEQIHTALPQQLALSRVRRTHQVGLITDAFVLEPFIHAVMQACEDGLRLPCGDGEGE
LRFECTEQLAGLALDEESEVRYLSAEQSNSSVVIGDRVVLKLIRRVNPGIHPELEMSAYL
TAAGFANISPLLAWVSRVDEQHAPHLLMIAQGYLSNQGDAWGWTQNTLERAIRDQMEPTR
NDAEAHTDALAELSGFAALLGQRLGEMHLLLAAPTEDPAFQPRPSDAQDSERWCAQISTE
LTHALDLLAQHRDTLDSDSQSLVDDLQQQRDGLAQHIDTLSKQAQGGLLMRVHGDLHLGQ
VLVVQGDAYLIDFEGEPARPLEERRAKHSPYKDVSGVLRSFDYAAAMILRSASAVDLSEP
ARQARQRVARQYLHQSRHAFVEAYGLATAAMPHAWQHAEGERAALELFCLEKAAYEITYE
AENRPSWLAVPLHGLHGLISTWGESE
NT seq 3321 nt NT seq  +upstreamnt  +downstreamnt
atggccaagcgttcccgcccggcagccttcatcgacgacccgctttggtacaaggatgct
gtcatctatcagttgcacatcaagtcattcttcgactcgaacaacgatggcatcggtgat
ttcgccggcctgatcagcaagctcgactatatcgccgagctgggtgtcaacaccttgtgg
ctgctgccgttctatccctcgccacgccgtgacgacggctacgacatcgccgaatacaag
gccgtgcaccccgactacggcagcatggccgacgcccgccgtttcatcgccgaggcccac
aagcgcggcctgcgggtgatcaccgagctggtcatcaaccacaccagcgaccagcacccg
tggttccagcgcgcccgccacgccaagcgcggcagcaaggcgcgcgagttttacgtgtgg
tcggacgacgaccagaagtacgacggcacgcgcatcatcttcctcgacaccgaaaagtcc
aactggacctgggacccggtcgccggccagtacttctggcaccggttctattcccaccag
ccggacctcaatttcgacaacccgcaggtgctcaaggcggtgatcggcgtcatgcgcttc
tggctcgacctgggtgtagatggcctgcggctggacgcgatcccttacctgatcgagcgc
gacggcaccaacaacgaaaacctcgccgaaacccacgacgtgctcaaggcgatccgcgcc
gagatcgacgccaactaccccgatcgcatgctgctggccgaagccaaccagtggccggaa
gacacgcgcccgtacttcggtgaaggcgacggcgacgaatgccatatggccttccacttt
ccgttgatgccgcgcatgtacatggccctggccatggaagaccgcttcccgatcaccgat
atcctgcgccagaccccggaaatcccggccaactgccagtgggcgatctttttgcgcaac
catgatgaactgaccctggaaatggtcaccgaccgcgagcgcgactacctgtggaactac
tacgccgaagaccgccgcgcgcgcatcaacctgggcattcgccggcgcctggcgcccctg
ctgcagcgtgaccgtcggcgcatagagctgctgaccagcctgctgttgtcgatgcccggc
acgccaaccctgtattacggcgacgaactgggcatgggcgacaatatctatctgggtgac
cgtgatggcgttcgcacacccatgcagtggtcgccagaccgcaacggcggtttttcccgc
gccgacccgcaacgcctggtgctgccgccgatcatggacccgctctacggttaccagacc
gtcaacgtcgaggcgcaaagccacgatccgcattcgctgctgaactggacccggcgcatg
ctggcggtgcgtaagcagcagaaggcctttggccgcggcagcctgcgcaccctcacgccc
agcaaccggcgcatccttgcctatatccgcgagtacaccgatgctgacggcaataccgag
gtcatcctctgcgtggccaacgtgtcccgcgccgcccaggctgccgaactcgaattgtca
caatacgccgacaaagtaccggtggagatgctgggcggcagcgcgttcccgccaatcggc
caactgccgtttctgctgaccttgccaccttatgcgttctactggttcctgctggccagc
cgcgatcgcatgcccagctggcacatccagcccaccgaggggttacccgaattgaccaca
ttggtactgcgcaagcgcatggaagaactgctgcaagcccccgcaagcgatacgctgcaa
agcaccatcctgccgcagtacctgcccaaacgccgctggttcgccggcaaggaagggccg
atcgatgccgtgcgcctgtgttacggcgtgcgtttcggcaccgccaccacgccggtgttg
ctcagcgaaatcgaggtactcagtgacggcacggccacctgctaccagctgccgttcggc
ctgctgcgtgaggaacagatccacaccgcgctgccgcagcagctggcgttgtcgcgggtg
cgccgtacccaccaggttggcttgatcacagacgccttcgtccttgagccgttcattcac
gctgtgatgcaagcctgcgaggatggactgcgtctgccgtgcggcgacggtgagggtgaa
ttgcgctttgaatgcacagagcagctggccggcctggcgctcgacgaggagagcgaagtg
cgctacctcagcgccgagcagtccaacagttcggtggtcatcggcgatcgcgtggtgctt
aaactgatccgccgggtcaacccgggtatccatccagagctggaaatgagtgcctacctg
accgccgccggctttgccaacatctcgccgctgctggcctgggtcagccgggtggacgag
caacacgcgccgcacctgctgatgattgctcagggttacctgagcaaccagggcgatgcc
tggggctggacccagaacacgctggaacgggccatccgcgaccagatggagcccacccgc
aacgacgccgaagcgcacactgacgcattggccgaactcagcggctttgccgccttgctt
ggccagcgcctgggcgagatgcacctgctgctggccgcacccaccgaagacccggccttc
cagccgcgccccagcgatgcgcaggacagcgagcgctggtgtgcacagatcagcaccgaa
ctgacccacgccctcgacctgctggcgcagcatcgcgacacactggacagcgacagccag
tccttggtcgacgacctgcagcaacagcgtgacggcctggcccagcacatcgacaccctg
agcaagcaggctcagggtggcctgctgatgcgtgtgcacggcgacctgcacctgggccag
gtgctcgtggtgcagggggatgcctacctcatcgattttgaaggtgaacccgcccggccc
cttgaagagcgccgggcaaaacacagcccctacaaggatgtcagcggcgtgctgcgatcc
ttcgactatgctgctgcgatgatcttgcgcagcgcgtctgcggtggacctttccgagccg
gcgcggcaagcccggcagcgggttgcccggcagtacctgcaccagtcccggcatgccttt
gtcgaagcctatgggctggccaccgccgccatgcctcacgcctggcagcacgccgagggt
gagcgcgcggcgctggaattgttctgcctggaaaaagccgcctacgagattacatacgaa
gccgaaaaccgtccgagctggctggccgtgcctttgcatggtctgcatggactgatcagt
acctggggagagtcagaatga

DBGET integrated database retrieval system