KEGG   Pseudomonas putida GB-1: PputGB1_4701Help
Entry
PputGB1_4701      CDS       T00650                                 

Definition
(GenBank) acetate--CoA ligase
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ppg  Pseudomonas putida GB-1
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ppg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PputGB1_4701
   00620 Pyruvate metabolism
    PputGB1_4701
   00640 Propanoate metabolism
    PputGB1_4701
  Energy metabolism
   00680 Methane metabolism
    PputGB1_4701
Enzymes [BR:ppg01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     PputGB1_4701
Lipid biosynthesis proteins [BR:ppg01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   PputGB1_4701
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
5253026..5254960
Genome map
AA seq 644 aa AA seqDB search
MFDIRNYPQALAVSQSATPTPDEYHRLYRQSVDDPDTFWAEQAKRLDWIKPWSSVQQCDL
NTGKARWFDGAQLNVSYNCIDRHLAQRGEQTALLWEGDDPKDSKAITYRELHRQVCRLAN
AMKARGVKKGDRVCIYMPMIPEAAFAMLACTRIGAIHSVVFGGFSPDALRDRILDADCRT
VITADEGVRGGKRVPLKQNVDKALASCPAVSSVLVVRRTGGDVAWAEGRDLWYHEVTEKA
GDDCPPEPMAAEDPLFILYTSGSTGKPKGVLHTTGGYLLQATMTFKVVFDYRDGEVFWCT
ADVGWVTGHSYIVYGPLANGAISLMFEGVPNYPDTSRFWQVVDKHQVNIFYTAPTALRAL
MREGSAPLQGTSRKSLRLLGSVGEPINPEAWEWYFEAVGQKRCPIVDTWWQTETGGIMLT
PLPGSQALKPGCATQPMFGVQPALLDEKGKLIEGPGAGLLVIKASWPGQIRSVYGDHQRM
VDTYFKPMPGYYFTGDGARRDADGDYWITGRIDDVINVSGHRIGTAEVESALVLHDSVAE
AAVVGYPHDLKGQGVYAFVTTMNGVTPDDTLKAELLALVSKEIGSFAKPELIQWAPALPK
TRSGKIMRRILRKIACNELDNLGDTSTLADPSVVQGLIDKRLNQ
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atgttcgatatccgcaactatccccaggctctggccgtcagccaatccgccacccccacc
cccgacgaataccatcgcctgtaccgccagtcggtcgacgatcctgacaccttctgggcc
gagcaggccaaacgcctggactggatcaagccctggtcgagcgtgcagcaatgcgacctg
aataccggcaaggcccgctggttcgacggtgcacagctcaacgtcagctataactgcatc
gaccgccatctagcccagcgcggcgagcagacggccctgctgtgggaaggtgacgaccca
aaagactccaaggccatcacttaccgcgagctgcaccgccaggtctgccgcctggccaat
gcaatgaaggcgcgcggggtcaagaaaggcgaccgggtgtgcatctacatgccgatgatc
cccgaagccgccttcgccatgctcgcctgcacccgcatcggggccatacattcggtagtg
ttcggcggtttttcccccgacgccctgcgcgaccgcatcctcgacgccgactgccgcacc
gtgatcaccgccgatgagggcgtgcgtggcggcaagcgtgtcccgctgaaacagaacgtc
gacaaggccttggccagctgcccagcggtcagcagcgtgttggtggtgcgccgcaccggc
ggcgatgtcgcctgggccgaaggccgcgacctctggtaccacgaagtaacggaaaaggcc
ggcgacgactgcccccccgagccgatggcggccgaagaccccctgttcatcctctatacc
tccggcagcaccggcaaaccaaaaggcgtgctgcacaccaccggcggctacctgctgcaa
gcgacaatgaccttcaaggtagtgttcgactaccgtgacggcgaggttttctggtgcact
gccgatgtcggctgggttaccggccacagctacatcgtctatggcccgctggccaatggc
gccatctcgctgatgttcgaaggcgtacccaactacccggacacttcacgcttctggcag
gtggtggacaagcaccaggtaaacattttctacaccgccccgaccgccctgcgcgcattg
atgcgcgagggctccgcgccgctgcagggcacctcgcgcaagagcctgcgcttgttgggc
agcgtcggcgagccgatcaaccctgaagcctgggaatggtatttcgaggcggtcgggcag
aagcgctgccccattgtcgatacctggtggcagaccgaaaccggcggcatcatgctcacc
ccgctgcccggctcgcaggcactcaaacccggttgcgccacacagcccatgtttggcgtg
caaccggcgctactggacgaaaaaggcaaactgatcgaaggccccggcgctggccttctg
gtcatcaaggccagctggcccgggcagatccgtagcgtctatggcgaccatcagcgcatg
gtcgacacctacttcaaacccatgcccggctactacttcaccggcgacggtgcccgccgc
gacgccgatggcgactactggatcaccgggcgcatcgacgatgtgatcaacgtgtccggg
caccgcataggcaccgccgaagtagaaagcgcactggtgctgcatgacagcgtcgccgag
gcagccgtggtcggttacccccacgacctcaagggccagggcgtctacgccttcgtcacg
accatgaatggcgtgacgccagacgacacgctaaaggccgagctgctggcactggtaagc
aaggaaatcggcagtttcgccaaacccgagctgattcagtgggcgccggcgctacccaag
acgcgctcaggcaagatcatgcggcgtatactgcgcaaaatcgcctgcaacgagctggac
aacctgggcgatacctcgacccttgccgaccccagcgtggtacagggcctgatcgacaaa
cgccttaaccagtaa

DBGET integrated database retrieval system