KEGG   Pseudoalteromonas phenolica: PP2015_4089Help
Entry
PP2015_4089       CDS       T04165                                 

Definition
(GenBank) Thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
pphe  Pseudoalteromonas phenolica
Pathway
pphe00240  Pyrimidine metabolism
pphe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pphe00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    PP2015_4089
Enzymes [BR:pphe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     PP2015_4089
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_30 AAA_22
Motif
Other DBs
NCBI-ProteinID: ALO44557
UniProt: A0A0S2K8E8
LinkDB All DBs
Position
II:846082..846663
Genome map
AA seq 193 aa AA seqDB search
MAQLYFYYSAMNAGKSTTLLQSAFNYRERGMTPLILTAAIDNRAGVGKVASRIGLEADAH
IYDRETNVFALVDRLNSENKLDCLLVDECQFLSKVQVNALTDVVDKLKIPVLCYGLRTDF
KGELFEGAQYLLAWADKLVELKTICHCGRKANRVLRTDEHGKAIHDGNQVEIGGNDRYVS
VCRTHYKEALSLL
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggctcagctttatttctattactcggcgatgaatgccggcaaatctacgacactcttg
caatctgcatttaattacagagaaaggggtatgactccactcatactgactgctgccatt
gataacagagcgggagtcggaaaggtagcttcgagaattggcctagaagcagatgcacat
atttatgatagagaaacaaatgtttttgctttggttgatagattaaatagtgagaacaaa
ttagattgtttacttgttgatgagtgccaatttttgagcaaggtacaggttaacgcactg
actgatgtggttgataagctgaagatacctgtgttgtgttatggcttacgtactgacttt
aaaggcgagttgtttgaaggcgcacaatatttattggcttgggcagacaagcttgtagag
cttaaaacgatatgtcactgtggcagaaaagcgaaccgtgttctgagaacagatgaacac
ggaaaagcaattcatgacggtaaccaggtagaaattggcggcaacgatagatatgtttca
gtttgccgcacccattataaagaagccctgtctctattataa

DBGET integrated database retrieval system