KEGG   Pannonibacter phragmitetus: APZ00_19225Help
Entry
APZ00_19225       CDS       T04214                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
pphr  Pannonibacter phragmitetus
Pathway
pphr00473  D-Alanine metabolism
pphr01100  Metabolic pathways
pphr01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pphr00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    APZ00_19225 (alr)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    APZ00_19225 (alr)
Enzymes [BR:pphr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     APZ00_19225 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:pphr01011]
 Precursor biosynthesis
  Racemase
   APZ00_19225 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ALV28913
UniProt: A0A0U3EBI6
LinkDB All DBs
Position
4223977..4225155
Genome map
AA seq 392 aa AA seqDB search
MTQDPQSMTSSSHGQTVIPAGSRLTIDPLAIARNWRRVKDQLTPGTQCAAAVKADAYGCG
LAVTVKHLAEAGCSTFFVATPQEGVTARQAAPNAIIYILNGLFPGAAPLLAEARLRPVLG
SLPEIEEWALFCRERKVKLEAAIHINTGMNRLGLNAPECERLAADGTLLEAFTASLLMSH
LACAPEPAHPMNKAQLAAFEAMSAHFPGVPRSLANSAGVFLGPEFHFDLVRPGIALYGGQ
IIDHPPLKLEPAIRLEARVLQVRKVPAGEGVGYGLARTAERDSRIAMISCGYGDGFLRGA
GSADGKPGASAWVDGHALPLFGRISMDMLAVDATDVPADKLRRGTYVELLGPNASLQAAA
SAAGTIDYELLTGLGSRHARIHGPLDGGTTGD
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgacacaggacccgcagagcatgacaagctccagtcacgggcaaaccgtcatcccggcc
ggcagccgtctgacgatcgatccgctcgccatcgcgcgcaactggcgccgcgtgaaggac
cagctcacgcccggcacccagtgcgccgccgccgtgaaagccgatgcctatggctgcggc
cttgccgtcacggtgaagcatctggcggaggccggctgctccaccttcttcgtggctacg
ccgcaggaaggcgtcactgcccgtcaggcagcgcccaatgccatcatctacatcctcaac
ggcctgttcccgggcgcagctcccctgctggctgaggcaaggctgcggccggtgctgggg
tccctgccggaaatcgaggaatgggcgctgttctgccgcgaacgcaaggtgaagctggaa
gcggccatccacatcaacaccggcatgaaccggctcggcctcaacgctcccgaatgcgag
cggctggcggcggatggcacgctgctggaagctttcaccgcgtcgctgctgatgagccat
ctggcctgtgcgccggaaccggcccatccgatgaacaaggcgcagcttgccgctttcgag
gcgatgagcgcgcatttccccggcgtgccgcgctcgctggccaattcggcgggcgtgttt
ctggggccggagttccatttcgatctggtgcgccccggcattgcgctctacggcggccag
atcatcgaccatccgcccctgaagcttgaaccggcgatccgtcttgaggcccgcgtgctg
caagtgcgcaaggtcccggctggcgaaggcgtcggctatggccttgcccgcacggcggag
cgcgacagccgcattgccatgatctcctgcggctatggcgacgggtttctcaggggcgcg
ggcagcgccgatggcaagccgggcgcatcggcctgggttgatgggcacgccctgcctctg
tttggccggatctccatggacatgctggctgtggatgccaccgatgttccggcagacaag
ctgcgccggggcacctatgtggagcttctgggccccaacgccagccttcaggcggcggca
tcggcggccggaacgattgattatgaactgctgacgggccttggaagccgccacgcgcgc
atccacgggccgctggacggcgggacgaccggagactga

DBGET integrated database retrieval system