KEGG   Phaeobacter piscinae: PhaeoP14_02901Help
Entry
PhaeoP14_02901    CDS       T05105                                 

Gene name
tuf1_1
Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
ppic  Phaeobacter piscinae
Brite
Translation factors [BR:ppic03012]
 Eukaryotic Type
  Elongation factors
   PhaeoP14_02901 (tuf1_1)
 Prokaryotic Type
   PhaeoP14_02901 (tuf1_1)
Mitochondrial biogenesis [BR:ppic03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    PhaeoP14_02901 (tuf1_1)
Exosome [BR:ppic04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PhaeoP14_02901 (tuf1_1)
  Exosomal proteins of breast cancer cells
   PhaeoP14_02901 (tuf1_1)
  Exosomal proteins of colorectal cancer cells
   PhaeoP14_02901 (tuf1_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW
Motif
Other DBs
NCBI-ProteinID: ATG40952
UniProt: A0A291FSD6
LinkDB All DBs
Position
complement(3038503..3039678)
Genome map
AA seq 391 aa AA seqDB search
MAKEKFERTKPHVNIGTIGHVDHGKTTLTAAITKYFGDFKAYDQIDGAPEEKARGITIST
AHVEYETEGRHYAHVDCPGHADYVKNMITGAAQMDGAILVVNAADGPMPQTREHILLGRQ
VGIPKMVVFMNKVDQVDDEELLELVEMEIRELLSSYDYPGDDIPIIAGSALAAMEGNKPE
IGEEKIKELMAAVDDYIDTPERAVDQPFLMPIEDVFSISGRGTVVTGRVERGVINVGDSI
EIVGIRDTSTTTCTGVEMFRKLLDRGEAGDNIGALLRGVDRDGVERGQVLCKPGSVKPHT
KFEAEAYILTKEEGGRHTPFFANYRPQFYFRTTDVTGTVTLPEGTEMVMPGDNLKFDVEL
IAPIAMEQGLRFAIREGGRTVGAGVVSKITE
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggctaaggaaaagtttgaacgtacaaaaccgcacgtcaacatcggcaccatcggccac
gttgaccacggcaagaccacgctgaccgcagcgatcaccaagtattttggtgacttcaaa
gcctacgaccagatcgacggcgcacctgaagagaaagcgcgcgggatcaccatctccacc
gcgcacgtggaatatgagaccgaaggccgtcactacgcccacgtcgactgccccggccac
gctgactatgtgaagaacatgatcaccggtgcggcgcagatggacggcgcgatcctggtt
gtgaacgctgctgacggcccgatgccgcagacccgcgagcacatcctgctgggccgccag
gttggcatcccgaagatggtcgtgttcatgaacaaagtggaccaggttgacgacgaagag
ctcctggagctggtcgaaatggaaatccgcgagctgctgtcgtcctacgactaccccggc
gacgatatcccgatcatcgcagggtccgctctggcggcgatggaaggcaacaagcctgaa
atcggcgaagagaaaatcaaggagctgatggcggctgttgacgattacatcgacacccct
gagcgtgctgttgaccagccgttcctgatgccgatcgaagacgtgttctcgatctccggt
cgtggtaccgttgtgaccggtcgtgttgagcgcggcgtgatcaacgttggcgactcgatc
gaaatcgttggtatccgtgacacctccaccaccacctgtaccggtgtggaaatgttccgc
aagctgctggatcgtggtgaagccggcgacaacatcggcgcgctgctgcgtggtgtcgac
cgtgacggcgttgagcgtggtcaggttctgtgtaagccgggttccgtgaagccgcacacc
aagttcgaagctgaggcctatatcctcaccaaagaagaaggtggtcgtcacaccccgttc
ttcgcgaactaccgtccgcagttctacttccgcaccaccgacgtgaccggcaccgtgacc
ctgcctgagggcaccgagatggttatgccgggcgacaacctgaagttcgacgttgaactg
atcgcaccgatcgcgatggagcagggcctgcgcttcgcgatccgcgaaggcggccgcacc
gtcggcgccggcgttgtgtcgaaaatcactgagtaa

DBGET integrated database retrieval system