KEGG   Pseudoalteromonas piscicida: B1L02_09310Help
Entry
B1L02_09310       CDS       T04942                                 

Definition
(GenBank) peptidyl-dipeptidase
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
ppis  Pseudoalteromonas piscicida
Brite
Enzymes [BR:ppis01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     B1L02_09310
Peptidases [BR:ppis01002]
 Metallo Peptidases
  Family M2
   B1L02_09310
Exosome [BR:ppis04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   B1L02_09310
CD molecules [BR:ppis04090]
 Proteins
  B1L02_09310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
1:1975478..1977298
Genome map
AA seq 606 aa AA seqDB search
MKPRFKLSVGALIVAGTFALSACKSTGVSNKALTEADAIAFLDKASEQLVDLNFRSSRSD
WIYSNFITHDTASLAADVNEEYTTALVELANQAAQFDGLNLSEDTRRKLDKLKLNLTLPA
PKDAEKTAELAKLTAELDGMYGKGKYCKDDGTCLSLGDMTAKMANSRDYEELLDIWQGWR
EVSKPMRPLYEKQVVLTNEGANELGYADTGAMWRSKYDMPADDFAKELDRTWEQVKPLYD
SLHCHVRAKLGEKYGEDKVPQDQPIPAHLLGNMWAQSWGNIYDLVAPENADPGYDVTALL
AKHNYDEIKMVKGAEKFFTSMGFAPLPETFYERSLFIKPKDRDVQCHASAWNLDAKDDLR
IKMCIQRTGEEFSVIHHELGHNFYQRAYNQQPVYYQESANDGFHEAIGDTIALSVTPGYL
KQIGLLDTVPDESKDIGLLMKMALDKVAFIPFGLLVDQWRWKVFSGEISPAEYNQAWWEL
REKYQGIKAPVSRTESDFDPGAKYHVPGNVPYTRYFLAHILQFQFHKSLCEIAGSKEAIH
RCSVYNSKAAGERLNAMLEMGSSKPWQQALKTLTGKDEMDATAVLDYFAPLQKYLDEQNK
GRNCGW
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccacgatttaaattaagtgttggcgcactcattgttgccggtacttttgcactc
tccgcttgtaaatccactggtgttagcaataaagccctgacagaagctgatgctattgca
tttttagacaaagcttctgaacagctggtcgatcttaacttccgctctagtcgctcagat
tggatctactcaaactttattacacacgacacggcctctcttgctgcggacgttaatgag
gaatataccactgcactcgttgaattagcgaaccaagccgcacagtttgatggtctaaat
ttaagcgaagatacgcgccgtaaactcgacaaattgaagctcaacctgacattgcctgca
ccaaaagacgctgaaaaaacagcagaacttgcaaagctcactgcagagcttgatgggatg
tacggaaaaggcaaatactgtaaagatgatggcacttgcctaagccttggcgacatgaca
gctaagatggcaaatagtcgcgactatgaagagcttttagacatctggcaaggctggcgc
gaagtatcaaagccaatgcgtccactctatgaaaagcaagtggtactaaccaatgagggt
gctaatgagcttggttacgcagacaccggcgctatgtggcgcagtaaatacgacatgcca
gcggacgactttgcaaaagagctggaccgtacctgggagcaagtcaagccgttatacgat
tcgcttcactgtcatgttagagccaaactgggcgaaaaatatggtgaagacaaagtgcct
caagatcagccaattcctgcacacctgcttggtaatatgtgggcacaaagctggggtaat
atctatgatctagtcgcgccagaaaatgcagatccgggttacgatgtaacggcgctactg
gctaaacataattacgacgaaatcaagatggtaaaaggtgcagagaagttctttacctca
atgggttttgcacctttacctgagaccttctacgaacgttctttatttattaaaccaaaa
gaccgcgacgtacaatgtcatgcgtcagcttggaacttagatgccaaagacgacctacgt
atcaaaatgtgtattcaacgcacgggtgaagagttctcagttatccaccatgaactcggc
cataacttctatcaacgcgcttacaatcaacagcctgtatattaccaagagagtgccaac
gatggcttccacgaagctatcggtgacactatcgcgctatctgtaacacctggctactta
aagcaaattggtttgttggataccgtaccagatgagtcaaaagatatcggtctattgatg
aagatggcactcgataaagtcgcattcattccatttggcctacttgtcgaccaatggcgc
tggaaagtattctctggtgagatttctccagcagagtacaaccaagcatggtgggaatta
agagagaaatatcaagggattaaagcaccagtttcacgtactgaaagtgactttgaccca
ggtgcaaaataccacgtaccaggtaatgtaccttacactcgttacttcctagcgcatatt
ttgcagttccaattccacaaatcactctgtgaaattgctggcagcaaagaagccattcac
cgctgctctgtttacaactcgaaagcggctggtgaacgtttaaatgccatgcttgaaatg
ggcagcagcaaaccttggcaacaagcacttaaaacgctaacaggtaaagatgaaatggat
gcaaccgcagtacttgactactttgcaccattgcaaaaatacctagatgagcaaaacaaa
ggccgtaactgcggctggtaa

DBGET integrated database retrieval system