KEGG   Pseudomonas plecoglossicida: RK21_00169Help
Entry
RK21_00169        CDS       T03646                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  
D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ppj  Pseudomonas plecoglossicida
Pathway
D-Alanine metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ppj00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    RK21_00169
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    RK21_00169
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    RK21_00169
Enzymes [BR:ppj01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     RK21_00169
Peptidoglycan biosynthesis and degradation proteins [BR:ppj01011]
 Precursor biosynthesis
  Amino acid ligase
   RK21_00169
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
174203..175159
Genome map
AA seq 318 aa AA seqDB search
MTSAYDKLHSTLDVKAFGRVAVLYGGKSAEREVSLKSGAAVIDALTTAGVDVVAIDVGDD
LLDRLQSEKIDRAFIILHGRGGEDGSMQGLLECLGIPYTGSGILASALAMDKLRTKQVWQ
SLGIPTPRHAVLASESDCLQASTELGFPLIVKPAHEGSSIGMAKVNSAQELVAAWQDAAK
YDSQVLVEQWIHGPEFTVAVLRGQVLPPIALGTPHVFYDYDAKYIANDTQYRIPCGLDSV
KEQELIDLTARACDAIGIEGWGRLDVMQDEQGRFWLLEVNTAPGMTDHSLVPMAARAAGL
DFQQLVLAILAESVATRG
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcgcctacgacaaactgcactcgaccctggacgtcaaggcgttcggccgcgtc
gcggtgctgtacggcggcaagagcgccgagcgcgaagtgtcgctcaagtccggcgccgca
gtgatcgacgcgctgaccaccgccggtgtcgacgtggtcgccatcgacgtgggggacgac
ctgctcgaccgcctgcaaagcgagaagatcgaccgcgccttcatcattctccacggtcgt
ggcggtgaagacggcagcatgcaaggcctgctcgagtgcctgggcattccctataccggc
agtggcatccttgcttcggcactggccatggacaagctgcgcaccaagcaggtgtggcag
agcctgggcattccgactccgcgccacgcagtgctggcgagcgaaagcgattgtttgcag
gccagtacggaactgggcttcccgcttatcgtcaaacccgcccatgaaggttccagcatc
ggcatggccaaggtgaacagcgcccaggaactggtcgccgcctggcaggacgcagctaaa
tacgattcccaggtactggtggagcagtggatccacgggccggagttcaccgtcgcggta
ttgcgcggccaggtgctgccgccgatcgccctgggtacgccgcacgtgttctacgactac
gacgccaagtacatcgccaacgatacccagtaccgcattccgtgcggcctggacagcgtc
aaggaacaggaactgatcgacctgaccgcgcgtgcctgcgatgccatcggcatcgaaggc
tgggggcggctggacgtgatgcaggacgagcagggccggttctggctgctcgaagtcaac
accgcacccggcatgaccgaccatagcctggtgcccatggcggcccgcgcggccggcctg
gacttccagcaactggtgctggcaatcctggccgagagcgtggcgacgcgaggttaa

DBGET integrated database retrieval system