KEGG   Pseudomonas plecoglossicida: RK21_04576Help
Entry
RK21_04576        CDS       T03646                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
ppj  Pseudomonas plecoglossicida
Brite
Translation factors [BR:ppj03012]
 Eukaryotic Type
  Elongation factors
   RK21_04576
 Prokaryotic Type
   RK21_04576
Mitochondrial biogenesis [BR:ppj03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    RK21_04576
Exosome [BR:ppj04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   RK21_04576
  Exosomal proteins of breast cancer cells
   RK21_04576
  Exosomal proteins of colorectal cancer cells
   RK21_04576
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(4776089..4777282)
Genome map
AA seq 397 aa AA seqDB search
MAKEKFDRSLPHVNVGTIGHVDHGKTTLTAALTRVCSEVFGSAVVEFDKIDSAPEEKARG
ITINTAHVEYNSNIRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLSRQVGVPYIVVFLNKADLVDDAELLELVEMEVRDLLSTYDFPGDDTPIIIGSARMALE
GKDDNEMGTTAVKKLVETLDAYIPEPVRAVDQPFLMPIEDVFSISGRGTVVTGRIERGIV
RVQDPLEIVGLRDTTTTTCTGVEMFRKLLDEGRAGENCGVLLRGTKRDDVERGQVLVKPG
SVKPHTKFTAEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTGNCELPEGVEMVMPGDNI
QMTVTLIKTIAMEDGLRFAIREGGRTVGAGVVAKIIE
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggctaaggaaaagtttgatcgttcccttccccacgttaacgtcggcactatcggccac
gttgaccacggtaagaccactctgaccgcagctctgactcgcgtctgctccgaagttttc
ggttcggcagtcgttgagttcgacaagatcgactcggctccggaagaaaaagcgcgcggt
atcaccatcaacaccgctcacgtcgagtacaactcgaacattcgtcactacgctcacgtt
gactgcccaggtcacgctgactacgtgaagaacatgatcaccggtgctgcccagatggac
ggcgcgatcctggtttgctcggccgccgatggtccgatgccacaaacccgtgagcacatc
ctgctgtcccgtcaggtaggcgtaccttacatcgtggtcttcctgaacaaggctgacctg
gtagacgacgccgagctgctggaactggtcgagatggaagttcgcgacctgctgtccacc
tacgacttcccaggcgacgacaccccgatcatcatcggttcggctcgtatggccctggaa
ggcaaagacgacaacgaaatgggtactaccgctgtcaagaagctggtagaaactctggat
gcctacatccctgagccggttcgtgccgttgaccagccgttcctgatgccgatcgaagac
gtattctcgatctcgggtcgtggtaccgttgttaccggtcgtatcgagcgtggtatcgtc
cgcgttcaggatccgctggaaatcgttggtctgcgtgacaccaccaccaccacctgcacc
ggtgttgagatgttccgcaagttgctggacgaaggccgtgctggcgagaactgcggcgtt
ctgctgcgtggtaccaagcgtgacgacgttgagcgtggccaggttctggtcaagccaggt
tcggtcaagccgcacaccaagttcaccgcagaagtctacgttctgtcgaaggaagaaggc
ggtcgtcacactccgttcttcaaaggctaccgtcctcagttctacttccgtaccactgac
gtgaccggtaactgcgaactgccggaaggcgttgaaatggtaatgccaggtgacaacatt
cagatgactgttaccctgatcaagaccatcgcaatggaagacggtctgcgcttcgctatc
cgtgaaggcggtcgtaccgtcggcgccggcgtcgtagcaaaaattattgaataa

DBGET integrated database retrieval system