KEGG   Pandoraea pnomenusa 3kgm: U875_13140Help
Entry
U875_13140        CDS       T02936                                 

Definition
(GenBank) alanine racemase
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
ppk  Pandoraea pnomenusa 3kgm
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ppk00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    U875_13140
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    U875_13140
Enzymes [BR:ppk01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     U875_13140
Peptidoglycan biosynthesis and degradation proteins [BR:ppk01011]
 Precursor biosynthesis
  Racemase
   U875_13140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(2872150..2873220)
Genome map
AA seq 356 aa AA seqDB search
MPRPIKVSIHTAALAHNLDVARRHAPHAKVWAVVKANAYGHGIENAYPGLRDADGFGLLD
LDEAVRLRELGWAGPILLLEGFFKPEDLAVVDKYGLTTTVHCDEQLRMLETTRLTKPLNV
QLKMNSGMNRLGFAPERFRAAWERARAIPGVSQIVLMTHFSDADGPRGIAYQMEAFERGA
CDVPGERSLANSAATLFHPGTHGAWVRPGIMLYGSSPKGVDVPAAELDLQPTMTLEAELI
GTQEVPAGGSVGYGSLFRADAPMRVGTVACGYADGYPRVAPTGTPVLVDGVRTRTVGRVS
MDMLAVDLTPVPQARVGTPVTLWGRGLSIDEVAASAGTLGYELMCAVTRRVPVHAN
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgccccgtccgatcaaagtctccattcacaccgcagcgctcgcccataatctcgatgtc
gcccgccgccacgcgccccacgccaaggtctgggcggtggtcaaggccaacgcctacggg
cacggcatcgagaacgcctatcccgggttgcgcgacgccgatggcttcggcctgctcgac
ctcgacgaggccgttcggcttcgcgagctcggatgggccggcccgattctgctgctggag
ggctttttcaagcccgaggatcttgccgtcgtcgacaagtacggcctgacgaccacggtg
cactgcgacgagcagctgcgtatgctcgagaccacgcggctgaccaagccgctcaacgtg
cagctcaagatgaactccggcatgaaccgcctggggttcgcgccagagcgttttcgtgcc
gcatgggagcgcgcccgtgcgattcccggcgtgagccagatcgtgttgatgacgcacttc
tcggatgccgacggtccgcgcggcatcgcctatcagatggaggcgttcgagcgcggcgcc
tgcgacgtgccgggcgagcgcagcctggccaactcggcggccaccttgtttcatccgggc
acgcatggcgcctgggtgcgcccgggcatcatgctctacggttcctcgcccaagggcgtc
gacgtgcctgcggcggaactcgatctgcaacccacgatgacgctcgaagccgagctgatc
ggtacccaggaagtgccggccggcggctcggtcggctacggcagcctgttccgcgccgat
gcgccgatgcgcgtgggcacggtggcctgtggctacgccgatggctatccgcgcgtcgcg
cccacgggcacgcccgtgctggtcgacggggtgcgtacgcgcacggtggggcgcgtctcg
atggacatgctcgcggtcgatctcacgccggtgccgcaggctcgcgtcggcacgccggtc
acgctctggggccgtggcctgagcatcgacgaagtggcggcctcggcgggcacgctcggc
tacgagctcatgtgcgccgtgacgcgccgcgtgccggtgcacgcgaactga

DBGET integrated database retrieval system