KEGG   Pandoraea pnomenusa 3kgm: U875_17475Help
Entry
U875_17475        CDS       T02936                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ppk  Pandoraea pnomenusa 3kgm
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:ppk00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    U875_17475
  Energy metabolism
   00680 Methane metabolism
    U875_17475
Enzymes [BR:ppk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     U875_17475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3791291..3794245
Genome map
AA seq 984 aa AA seqDB search
MKSSAKAKAPREGLAKSVGNTPPAKAAAAAPSTPRPAKRVPDAAAAPKTRRSREDKDAPL
REDIRFLGRLLGDVLREQQGSDAFDLVETIRQNAVRFHREGDRSAAKALDTLLNGLTNEQ
AIQVVRAFSYFSHLANIAEDRHHNRRRRVHALAGSRAQPGTIRAALQSLKDAGRADPATL
QAFFASALIVPVLTAHPTEVQRKSILDAEREVARLLEHRDDALTERESSRNTESMRAYVT
TLWQTRMLRSSRLTVADEIENALSYYRSTFLSEIPALYDDVAAELHDAVPSVRAEGLGRF
LQMGSWIGGDRDGNPNVTAQTLQLAITRQATEIFAHYLEEVHLLGAELSVSQLLAGASDA
LLTLARRSPDDSPHRTDEPYRRALIGVYARLAATAREWVGHVPHRGAVGDASPYLDASEF
ISDLNTVVASLVAHHGSALISQRLGPLVRAAEVFGFHLASIDLRQSSDVHEAVIAELFAK
AGVEANYAKLDEAAKLALLLRELREPRALFSPYLDYSQRTRDELAVFAAAREIRARFGAR
AVRNYIISHTETVSDLVEVMLLQKETGLFQGALGGKGAKGVEPKVGAMVIPLFETIADLR
NAPVIMREFFDIPGMSEVVVQQGGEQEVMLGYSDSNKDGGFLTSNWELYKAELALVRLFE
EKGIRLRLFHGRGGTVGRGGGPTYQAILSQPPGTVNGQIRLTEQGEIIASKFANPEIGRR
NLETIVAATLEATLLPSRNQPPRLAAYEQVMQALSDTAFAAYRDLVYETPGFTDYFFSAT
PIAEIAELNIGSRPASRKFSDPKNRRIEDLRAIPWGFSWGQCRLLLTGWYGFGSAVSAYL
DDGDAAGRDKRLDTLRQMVKRWPFFANLLSNMDMVLAKTDLAVASRYAELVPDEKLRKRV
FSRIVAEWQGTTQALALITGHDERLADNPLLARSIKNRFPYLDPLNHLQVELLRRHRAGE
SDERARRGIHLSINGIAAGLRNTG
NT seq 2955 nt NT seq  +upstreamnt  +downstreamnt
atgaagagcagcgcaaaggcaaaagccccgcgagagggcctcgccaagtcggtcggcaac
actccccccgcgaaggcagcagccgcggcaccatccactccccgcccggcgaaacgcgtg
ccggacgccgccgcggcaccgaagacccgccgttcgcgcgaagacaaggacgccccgctg
cgcgaggacattcgcttcctcggccgcctgctcggcgacgtcctgcgcgagcagcagggc
agcgatgcgttcgatctcgtcgaaaccatccgccagaatgccgtgcgctttcaccgcgag
ggcgatcgcagtgccgcgaaggcgctcgacacgctgctcaacggcctgaccaatgaacag
gcgatccaggtggtgcgtgcgttcagctacttttcgcatctggcgaacatcgccgaggac
cggcatcacaaccgccgccgccgcgtgcacgcgctcgcgggcagccgcgcccagccgggc
acgattcgcgccgcgctgcaaagcctgaaggacgccggtcgcgccgatcccgccacgctc
caggccttcttcgccagcgcgctcatcgtgccggtgctgaccgcccacccgacggaagtc
cagcgcaagagcattctcgacgcggagcgcgaggtcgcccgcctgctcgaacatcgcgac
gacgcgctcaccgagcgcgaatcctcgcgcaacaccgagtcgatgcgtgcctacgtgacc
acgctctggcagacgcgcatgctgcgcagctcgcgcctgacggtggccgacgaaatcgag
aacgcgctgtcgtattaccgcagcacgttcctgtccgaaattcccgcgctgtacgacgat
gtggccgccgagctgcacgacgccgtgcccagcgtgcgcgccgaaggtctcggacgtttc
ctgcaaatggggagctggatcggcggcgatcgcgacggcaacccgaacgtgaccgcccag
accctgcaactggccatcacgcgccaggccacggaaatcttcgcgcactacctcgaagaa
gtgcacttgctgggcgcggaactctccgtctcgcagctgctcgccggcgccagcgacgcg
ctgctcaccctggcgcgccgctcgcccgacgactcgccgcaccgcaccgacgagccctat
cgccgtgcgctgatcggcgtgtatgcgcgcctggccgcgaccgcgcgcgagtgggtcggc
cacgtgccgcatcgcggcgcggtcggcgacgcaagcccatatctcgacgccagcgaattc
atctccgatctgaacacggtcgtcgcgtcgctcgtggcgcatcacggcagcgcattgatt
tcgcaacgcctcggcccgctggtgcgcgccgccgaggtgttcggcttccatctcgcgagc
atcgacctgcgccaaagctccgacgtgcacgaagccgtgattgccgagctattcgccaag
gcgggcgtcgaagcgaactacgcgaaactcgacgaagcggccaagcttgcgctgttgttg
cgcgaactgcgcgagccgcgtgcgctcttctcgccgtatctcgactactcgcaacgcacg
cgcgacgagctggccgtattcgccgccgcacgtgagattcgcgcccgcttcggcgcgcgc
gcggtgcgcaactacatcatttcgcacacggaaaccgtgagcgatctggtcgaagtcatg
ctgctgcaaaaggagacgggcctgtttcagggcgcgctgggcggcaagggcgcgaagggc
gtcgagccgaaggtcggcgccatggtcattccgctgttcgagacgatcgccgacctgcgc
aatgcgccggtcatcatgcgcgagttcttcgacattcccggcatgtccgaggtcgtggtg
cagcaaggcggcgagcaggaagtcatgctcggctattccgacagcaacaaggacggcggc
ttcctcacctcgaactgggagttgtacaaggccgaactcgcgctggtgcgactgttcgag
gagaaaggcatccgcctgcgcctgttccacggccggggcggcaccgtcggacgcggcggc
ggcccgacctatcaggccatcctctcgcaaccgccgggcaccgtgaacggacagattcgc
ctgaccgaacagggcgagatcatcgcgagcaagttcgccaatccggaaatcggacggcgc
aatctcgagacgatcgtggccgccacgcttgaagccacgctgctgccgagccgcaaccag
ccgccgcgactggccgcatacgagcaggtcatgcaggcactgtcggacacggcatttgcc
gcgtatcgcgacctcgtctatgaaacgccgggcttcaccgactatttcttctcggccacg
ccgatcgcggaaatcgccgagctcaacatcgggtcgcgccccgcttcgcgcaagttctcc
gaccccaagaaccgccgcatcgaggaccttcgcgccattccatggggcttctcgtggggg
caatgccgcttgctgctcaccggttggtacggtttcggcagcgcggtgagcgcgtatctg
gacgacggcgacgccgccggccgggacaagcgcctcgacacgctgcgtcagatggtcaag
cgctggccgttcttcgcgaatctgctctcgaacatggacatggtgctcgccaagaccgac
ctggccgtggcctcgcgttacgccgagctggtaccggacgaaaaactgcgcaagcgcgtg
ttcagccgcatcgtggccgaatggcagggcacgacgcaggcgctcgcgctgatcaccggc
catgatgagcgcctggccgacaacccgctgctcgcacgctcgatcaagaatcgcttcccg
tacctcgatccgctcaatcacttgcaggtcgagttgctgcggcgccaccgcgcgggtgag
tcggacgaacgcgcgcggcgcggcatccacctgtccatcaacgggatcgcggccggtctg
cgcaacaccggctga

DBGET integrated database retrieval system