KEGG   Pan paniscus (bonobo): 100979709Help
Entry
100979709         CDS       T02283                                 

Gene name
ASH1L
Definition
(RefSeq) ASH1 like histone lysine methyltransferase
  KO
K06101  
histone-lysine N-methyltransferase ASH1L [EC:2.1.1.43]
Organism
pps  Pan paniscus (bonobo)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:pps00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100979709 (ASH1L)
Enzymes [BR:pps01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100979709 (ASH1L)
Chromosome [BR:pps03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100979709 (ASH1L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
1
AA seq 2964 aa AA seqDB search
MDPRNTAMLGLGSDSEGFSRKSPSAISTGTVVSKREVELEKNTKEEEDLRKRNRERNIEA
GKDDGLTDAQQQFSVKETNFSEGNLKLKIGLQAKRTKKPPKNLENYVCRPAIKTTIKHPR
KALKSGKMTDEKNEHCPSKRDPSKLYKKADDVAAIECQSEEVIHLHSQGENNPLSKKLSP
VHSEMADYINATPSTLLGSRDPDLKDRALLNGGTSVTEKLAQLIATCPPSKSSKTKPKKL
GTGTTAGLVSKDLIRKAGVGSVAGIIHKDLIKKPTISTAVGLVTKDPGKKPVFNAAVGLV
NKDSVKKLGTGTTAVFINKNLGKKPGTITTVGLLSKDSGKKLGIGIVPGLVHKESGKKLG
LGTVVGLVNKDLGKKLGSTVGLVAKDCAKKIVASSAMGLVNKDIGKKLVSCPLAGLISKD
AINLKAEALLPTQEPLKASCSTNINNQESQELSESLKDSATSKTFEKNVVRQNKESILEK
FSVRKEIINLEKEMFNEGTCIQQDSFSSSEKGSYETSKHEKQPPVYCTSPDFKMGGASDV
STAKSPFSAVGESNLPSPSPTVSVNPLTRSPPETSSQLAPNPLLLSSTTELIEEISESVG
KNQFTSESTHLNVGHRSVGHSISVECKGIDKEVNDSKTTHIDIPRISSSLGKKPSLTSES
SIHTITPSVVNFTSLFSNKPFLKLGAVSASDKHCQVAESLSTSLQSKPXKKRKGRKPRWT
KVVARSTCRSPKGLELERSELFKNVSCSSLSNSNSEPAKFMKNIGPPSFVDHDFLKRRLP
KLSKSTAPSLALLADSEKPSHKSFATHKLSSSMCVSSDLLSDIYKPKRGRPKSKEMPQLE
GPPKRTLKIPASKVFSLQSKEEQEPPILQPEIEIPSFKQGLSVSPFPKKRGRPKRQMRSP
VKMKPPVLSVAPFVATESPSKLESESDNHRSSSDFFESEDQLQDPDDLDDSHRPSVCSMS
DLEMEPDKKXTKRNNGQLMKTIIRKINKMKTLKRKKLLNQILSSSVESSNKGKVQSKLHN
TVSSLAATFGSKLGQQINVSKKGTIYIGKRRGRKPKTVLNGILSGSPTSLAVLEQTAQQA
AGSALGQILPPLLPSSAGSSEILPSPICSQSSGTSGGQSPVSSDAGFVEPSSVPYLHLHS
RQGSMIQTLAMKKASKGRRRLSPPTLLPNSPSHLSELTSLKEATPSPISESHSDETIPSD
SGIGTDNNSTSDRAEKFCGQKKRRHSFEHVSLIPPETSTVLSSLKEKHKHKCKRRNHDYL
SYDKMKRQKRKRKKKYPQLRNRQDPDFIAELEELISRLSEIRITHRSHHFIPRDLLPTIF
RINFNSFYTHPSFPLDPLHYIRKPDLKKKRGRPPKMREAMAEMPFMHSLSFPLSSTGFYP
SYGMPYSPSPLTAAPIGLGYYGRYPPTLYPPPPSPSFTTPLPPPSYMHAGHLLLNPAKYH
KKKHKLLRQEAFLTTSRTPLLSMSTYPSVPPEMAYGWMVEHKHRHRHKHREHRSSEQPQV
SMDTGSSRSVLESLKRYRFGKDAVGERYKHKEKHRCHMSCPHLSPSKSLINREEQWVHRE
PSESSPLALGLQTPLQIDCSESSPSLSLGGFTPNSEPASSDEHTNLFTSAIGSCRVSNPN
SSGRKKLTDSPGLFSAQDTSLNRLHRKESLPSNERAVQTLAGSQPTSDKPSQRPSESTNC
SPTRKRSSSESTSSTVNGVPSRSPRLVASGDDSVDSLLQRMVQNEDQEPMEKSIDAVIAT
ASAPPSSSPGRSHSKDRTLGKPDSLLVPAVASDSCNNSISLLSEKLTSSCSPHHIKRSVV
EAMQRQARKMCNYDKILATKKNLDHVNKILKAKKLQRQARTGNNFVKRRPGRPRKCPLQA
VVSMQAFQAAQFVNPELNRGEEGAALHLSPDTVTDVIEAVVQSVNVNPEHKKGLKRKGWL
LEEQTXKKQKPLPEEEEQENNKSFNEAPVEIPSPSETPAKPSEPESTLQPVLSLIPREKK
PPRPPKKKYQKAGLYSDVYKTTDPKSRLIQLKKEKLEYTPGEHEYGLFPAPIHVGKYLRQ
KRIDFQLPYDILWQWKHNQLYKKPDVPLYKKIRSNVYVDVKPLSGYEATTCNCKKPDDDT
RKGCVDDCLNRMIFAECSPNTCPCGEQCCNQRIQRHEWVQCLERFRAEEKGWGIRTKEPL
KAGQFIIEYLGEVVSEQEFRNRMIEQYHNHSDHYCLNLDSGMVIDSYRMGNEARFINHSC
DPNCEMQKWSVNGVYRIGLYALKDMPAGTELTYDYNFHSFNVEKQQLCKCGFEKCRGIIG
GKSQRVNGLTSSKNSQPMATHKKSGRSKEKRKSKHKLKKRRGHLSEEPSENINTPTRLTP
QLQMKPMSNRERNFVLKHHVFLVRNWEKIRQKQEEVKHTSDNIHSASLYTRWNGICRDDG
NIKSDVFMTQFSALQTARSVRTRRLAAAEENIEVARAARLAQIFKEICDGIISYKDSSRQ
ALAAPLLNLPPKKKNADYYEKISDPLDLITIEKQILTGYYKTVEAFDADMLKVFRNAEKY
YGRKSPVGRDVCRLRKAYYNARHEASAQIDEIVGETASEADSSETSVSEKENGHEKDDDV
IRCICGLYKDEGLMIQCDKCMVWQHCDCMGVNSDVEHYLCEQCDPRPVDREVPMIPRPHY
AQPGCVYFICLLRDDLLLRQGDCVYLMRDSRRTPDGHPVRQSYRLLSHINRDKLDIFRIE
KLWKNEKEERFAFGHHYFRPHETHHSPSRRFYHNELFRVPLYEIIPLEAVVGTCCVLDLY
TYCKGRPKGVKEQDVYICDYRLDKSAHLFYKIHRNRYPVCTKPYAFDHFPKKLTPKKDFS
PHYVPDNYKRNGGRSSWKSERSKPPLKDLGQEDDALPLIEEVLASQEQAANEISSLEEPE
REGATANVSEGXKKTEESSQEPQSTCTPEERRHNQRERLNQILLNLLEKIPGKNAIDVTY
LLEEGSGRKLRRRTLFIPENSFRK
NT seq 8895 nt NT seq  +upstreamnt  +downstreamnt
atggaccctagaaatactgctatgttaggattgggttctgattccgaaggtttttcaaga
aagagtccttctgccatcagtactggcacagtggtcagtaagagagaagtagagctagaa
aaaaacacaaaggaggaagaggaccttcgcaaacggaatcgagaaagaaacatcgaagct
gggaaagatgatggtttgactgatgcacagcaacagttttcagtgaaagaaacaaacttt
tcagagggaaatttaaaattgaaaattggcctccaggctaagagaactaaaaaacctcca
aagaacttggagaactatgtatgtcgacctgccataaaaacaactattaagcacccaagg
aaagcacttaaaagtggaaagatgacggatgaaaagaatgaacactgtccttcaaaacga
gacccttcaaagttgtacaagaaagcagatgatgttgcagccattgaatgccagtctgaa
gaagtcatccatcttcattcacagggagaaaacaatcctttgtctaagaagctgtctcca
gtacactcagaaatggcagattatattaatgcaacaccatctactcttcttggtagccgg
gatcctgatttaaaggacagagcattacttaatggaggaactagtgtaacagaaaagttg
gcacagctgattgctacctgtcctccttccaagtcttccaagacaaaaccgaagaagtta
ggaactggcactacggcaggattggttagcaaggatttgatcaggaaagcaggtgttggc
tctgtagctggaataatacataaggacttaataaaaaagccaaccatcagcacagcagtt
ggattggtaactaaagatcctgggaaaaagccagtgtttaatgcagcagtaggattggtc
aataaggactctgtgaaaaaactgggaactggcactacagcggtattcattaataaaaac
ttaggcaaaaagccaggaactatcactacagtaggactgctaagcaaagattcaggaaag
aagctaggaattggtattgttccaggtttagtgcataaagagtctggcaagaagttagga
cttggcactgtggttggactggttaataaagatttgggaaagaaattgggttctactgtt
ggcctagtggccaaggactgtgcaaagaagattgtagcaagttcagcaatgggattggtt
aataaggacattggaaagaaactagtgagttgtcctttggcaggtctgatcagtaaagat
gccataaaccttaaagccgaagcactgctccccactcaggaaccacttaaggcttcttgt
agtacaaacatcaataatcaggaaagtcaggaactttctgaatccctgaaagatagtgcc
accagcaaaacttttgaaaagaatgttgtacggcagaataaagaaagcatattggaaaag
ttctcagtacgaaaagaaatcattaatttggagaaagaaatgtttaatgaaggaacatgc
attcagcaagacagtttctcatccagtgaaaagggatcttatgaaacctcaaagcatgaa
aagcagcctcctgtatattgcacttctccggactttaaaatgggaggtgcttctgatgta
tctacggctaaatccccattcagtgcagtaggagaaagcaatctcccttccccatcacct
actgtatctgttaatcctttaaccagaagtccccctgaaacttcttcacagttggctcct
aatccattacttttaagttctactacagaactaatcgaagaaatttctgaatctgttgga
aagaaccagtttacttctgaaagtacccacttgaacgttggtcataggtcagtgggtcat
agtataagtgttgaatgtaaagggattgataaagaggtaaatgattcaaaaactacccat
atagatattccaagaataagctcttcccttggaaaaaagccaagtttgacttctgaatcc
agcattcatactattactccttcagttgttaacttcactagtttatttagtaataagcct
tttttaaaactgggtgcagtatctgcatcagacaaacactgccaagttgctgaaagccta
agtactagtttgcagtccaaaccanttaaaaaaagaaagggaagaaaacctcggtggact
aaagtggtggcaagaagcacatgccggtctccaaaagggctagaattagaaagatcagag
ctttttaaaaacgtttcatgtagctcactatcaaatagtaattctgagccagccaagttt
atgaaaaacattggacccccttcatttgtagatcatgacttccttaaacgccgattgcca
aagttgagcaaatccacagctccatctcttgctctcttagctgatagtgaaaaaccatct
cataagtcttttgctactcacaaactatcctccagtatgtgtgtctctagtgaccttttg
tctgatatttataagcccaaaagaggaaggcctaaatctaaggagatgcctcaactggaa
gggccacctaaaaggactttaaaaatccctgcttctaaagtgttttctttacagtctaag
gaagaacaagaacccccaattttacagccagaaattgaaatcccttccttcaaacaaggt
ctgtctgtgtctccttttccaaaaaagagaggcaggcctaagaggcaaatgaggtcacca
gtcaagatgaagccacctgtactgtcagtggctccatttgttgccactgaaagtccaagc
aagctagaatctgaaagtgacaaccatagaagtagcagtgatttctttgagagcgaggat
caacttcaggatccagatgacctagatgacagtcataggccaagtgtctgtagtatgagt
gaccttgagatggaaccagataaaaaanttaccaagagaaacaatggacaattaatgaaa
acaattatccgcaaaataaataaaatgaagactttaaagagaaagaaactgttgaatcag
attctttcaagttctgtagaatcaagtaataaagggaaagtgcaatccaaactccataat
acggtatcaagtcttgctgccacatttggctctaaattgggccaacagataaatgtcagc
aagaaaggaaccatttatataggaaagagaagaggtcgcaaaccaaaaactgtcttaaat
ggtattctttctggtagtcctactagccttgctgttcttgagcaaacagctcaacaggca
gctgggtcagcattaggacagattcttcccccattactgccttcatctgctggtagttct
gagattcttccatcacctatttgctctcagtcttctgggactagtggaggtcagagccct
gtaagtagtgatgcaggttttgttgaacccagttcagtgccatatttgcatttacactcc
agacagggcagtatgattcagactcttgcaatgaagaaggcctcaaaggggaggaggcgg
ttatctcctcctactttgttgccaaattctccttcgcacttgagtgaactcacatctcta
aaagaagctactccttccccaatcagtgagtctcatagtgatgagaccattcccagtgat
agtggaattggaacagataataacagcacatcagacagggcagagaaattttgtgggcaa
aaaaagaggaggcattcttttgagcatgtttctctgattccccctgaaacctctacagtg
ctaagcagtcttaaagaaaaacataaacacaaatgtaagcgcaggaatcatgattacctc
agctatgacaagatgaaaaggcagaaacgaaaacggaaaaagaaatatccccagcttcga
aatagacaggatccagactttattgcagagctggaggaactaataagtcgcctaagtgaa
attcggatcactcatcgaagtcatcattttatcccccgagatcttctgccaactatcttt
cgaatcaactttaatagtttctatacacatccttctttccccttagaccctttgcactac
attcgaaaacctgacttaaaaaagaaaagagggagaccccctaagatgagggaggcaatg
gctgaaatgccttttatgcacagccttagttttcctctttctagtactggattctatcca
tcttatggtatgccttactctccttcaccccttacagctgctcccataggattaggttac
tatggaaggtatcctcccactctttatccacctcctccatctccttctttcaccacgcca
cttccacctccttcctatatgcatgctggtcatttacttctcaatcctgccaaataccat
aagaaaaagcataagctacttcgacaggaggcctttcttacaaccagcaggactcccctc
ctttccatgagtacctaccccagtgttcctcctgagatggcctatggttggatggttgag
cacaaacacaggcaccgtcacaaacacagagaacaccgttcttctgaacaaccccaggtt
tctatggacactggctcttcccgatctgtcctggaatctttgaagcgctatagatttgga
aaggatgctgttggagagcgatataagcataaggaaaagcaccgttgtcacatgtcctgc
cctcatctctctccttcaaaaagcttaataaacagagaggaacagtgggtccaccgagag
ccttcagaatctagtccattggccttgggattgcagacacctttacagattgactgttca
gaaagttctccaagcttatcccttggaggattcactcccaactctgagccagccagcagt
gatgaacatacaaaccttttcacaagtgcaataggcagctgcagagtttcaaaccctaac
tccagtggccggaagaaattaactgacagccctggactcttttctgcacaggacacttca
ctaaatcggcttcacagaaaggagtcactgccttctaacgaaagggcagtacagactttg
gcaggctcccagccaacctctgataaaccctcccagcggccatcagagagcacaaattgt
agccctacccggaaaaggtcttcatctgagagtacttcttcaacagtaaacggagttccc
tctcgaagtccaagattagttgcttctggggatgactctgtggatagtctgctgcagcgg
atggtacaaaatgaggaccaagagcccatggagaaaagtattgatgctgtgattgcaact
gcctctgcaccaccttcttccagtccaggccgtagccacagcaaggaccgaaccctggga
aaaccagacagccttttagtgcctgcagtcgcaagtgactcttgcaataatagcatctca
ctcctatctgaaaagttgacaagcagctgttccccgcatcatatcaagagaagtgtagtg
gaagctatgcaacgccaagctcggaaaatgtgcaattacgacaaaatcttggccacaaag
aaaaacctagaccatgtcaataaaatcttaaaagccaaaaaacttcaaaggcaggccagg
acagggaataactttgtgaaacgtaggccaggtcgacctcggaaatgtccccttcaggct
gtcgtatcaatgcaagcattccaggctgctcagtttgtcaacccagaattgaacagaggc
gaggaaggagcagcactgcacctcagtcctgacacagttacagatgtaattgaggctgtt
gttcagagtgtaaatgtgaacccagaacataaaaaggggttgaagagaaaaggttggcta
ttggaagaacagaccnagaaaaagcagaagccattaccagaggaagaagagcaagagaat
aataaaagctttaatgaagcaccagttgagattcccagtccttctgaaaccccagctaaa
ccttctgaacctgaaagtaccttgcagcctgtgctttctctcatcccaagggaaaagaag
cccccacgtcccccaaagaagaagtatcagaaagcagggctgtattctgacgtttacaaa
actacagacccaaagagtcgattgatccaattaaagaaagagaagctggagtatactcca
ggagagcatgaatatggattatttccagcgcccattcatgttggaaagtatctaagacaa
aagagaattgacttccagcttccttatgatatcctttggcagtggaaacacaatcagcta
tacaaaaagccagatgtcccactatataagaaaattcgttcaaatgtttacgttgatgtc
aaacccctttctggttacgaagctaccacctgtaactgtaagaagccagatgatgacacc
aggaagggctgtgttgatgactgcctcaatagaatgatctttgctgagtgttcccccaac
acttgcccatgtggcgagcaatgctgtaaccagaggatacagaggcatgaatgggtgcaa
tgtctagaacgatttcgagctgaggaaaaaggctggggaatcagaaccaaagagccccta
aaagctgggcagttcatcattgaatacctaggggaagtcgtcagcgaacaggagttcagg
aacaggatgattgagcagtatcataatcacagtgaccactactgcctgaacctggatagt
gggatggtgattgacagttaccgcatgggaaatgaggcccgattcatcaaccatagctgt
gacccaaattgtgaaatgcagaaatggtctgttaatggagtataccggattggactctat
gctcttaaagacatgccagctgggactgaactcacttatgattataactttcattccttc
aatgtggaaaaacagcaactttgtaagtgtggctttgagaaatgtcgaggaatcatcgga
ggcaagagtcagcgtgtgaatggactcaccagcagcaaaaacagccagcccatggccaca
cacaaaaaatctggacggtcaaaagagaagagaaagtctaagcacaagctgaagaaaagg
agaggccatctctctgaggaacccagtgaaaatatcaacaccccaactagattgaccccc
caattacagatgaagccaatgtccaatcgtgaaaggaactttgtgttaaagcatcatgta
ttcttggtccgaaactgggagaagattcgtcaaaaacaggaggaagtaaagcacaccagt
gataatattcactcagcatcattatatacccgttggaatgggatctgccgagatgatggg
aatatcaagtctgatgtcttcatgacccagttctctgccctgcagacagctcgatctgtt
cgaacaagacggttggcagctgcagaggaaaatattgaagtggctcgggcagcccgccta
gcccagatcttcaaagaaatttgtgatggtatcatctcttataaagattcttcccggcaa
gcactggcagctccacttttgaaccttcccccaaagaaaaagaatgctgattattatgag
aagatctctgatcccctagatcttatcaccatagagaagcagatcctcactggttactat
aagacagtggaagcttttgatgctgacatgctcaaagtctttcggaatgctgagaagtac
tatgggcgtaaatccccagttgggagagatgtttgccgtctacgaaaggcctattacaat
gcccggcatgaggcatcagcccagattgatgagattgtgggagagacagcaagtgaggca
gacagcagtgagacctcagtctctgaaaaggagaatgggcatgagaaggacgacgatgtt
attcgctgtatctgtggcctctacaaggatgaaggtctcatgatccagtgtgacaagtgc
atggtatggcagcactgtgattgtatgggagtgaactcagatgtggagcactacctttgt
gagcagtgtgacccaaggcctgtggacagggaggttcccatgatccctcggccccactat
gcccaacctggctgtgtctacttcatctgtttgctccgagatgacttgctgcttcgtcag
ggtgactgtgtgtatctgatgagggatagtcggcgcacccctgatggccacccggtccgt
cagtcctatcgactgttatctcacattaaccgagataaacttgacatctttcgcattgag
aagctttggaagaatgaaaaagaggaacggtttgcctttggtcaccattatttccgtccc
cacgaaacacaccactctccatcccgtcggttctatcataatgaactatttcgggtgcca
ctctatgagatcattcccttggaggctgtagtggggacctgctgtgtgttggacctttat
acgtattgtaaagggagacccaaaggagtaaaggagcaagatgtgtacatctgtgattat
cggcttgacaagtcagcacacctgttttacaagatccaccggaaccgctatcctgtctgc
accaaaccctatgcttttgatcacttccccaagaagctcactcccaaaaaagatttctcg
cctcattacgtcccagacaactacaagaggaatggaggacgatcatcctggaagtctgag
cgctcaaagccacccctaaaagacttgggccaggaggatgatgctctacccttgattgaa
gaggttctggccagtcaagagcaagcagccaatgagatatccagcctggaggagccagaa
cgggaaggggccactgctaacgtcagtgagggtngaaaaaaaacagaggaaagtagtcaa
gaaccccagtcaacctgtacccctgaggaacgacggcataaccaacgggaacgactcaac
cagatcttgctcaatctccttgaaaaaatccctggaaaaaatgccattgatgtgacctac
ttgctggaggaaggatcaggcaggaaactgcgaaggcgtactttgtttatcccagaaaac
agctttcgaaagtga

DBGET integrated database retrieval system