KEGG   Pan paniscus (bonobo): 100980711Help
Entry
100980711         CDS       T02283                                 

Definition
(RefSeq) angiotensin-converting enzyme
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
pps  Pan paniscus (bonobo)
Pathway
Renin-angiotensin system
Renin secretion
Chagas disease (American trypanosomiasis)
Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:pps00001]
 Organismal Systems
  Endocrine system
   04924 Renin secretion
    100980711
   04614 Renin-angiotensin system
    100980711
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    100980711
  Infectious diseases
   05142 Chagas disease (American trypanosomiasis)
    100980711
Enzymes [BR:pps01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     100980711
Peptidases [BR:pps01002]
 Metallo Peptidases
  Family M2
   100980711
Exosome [BR:pps04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100980711
CD molecules [BR:pps04090]
 Proteins
  100980711
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
17
AA seq 732 aa AA seqDB search
MGQGWATAGLPSLLFLLLCYGHPLLVPSQEAPRQVTVTHGTSSQATTSGQTTTHQATAHQ
TSAQSPNLVTDEAEASKFVEEYDRTSQVVWNEYAEANWNYNTNITTETSKILLQKNMQIA
NHTLKYGTQARRFDVNQLQNTTIKRIIKKVQDLERAALPAQELEEYNKILLDMETTYSVA
TVCHTNGSCLQLEPDLTNVMATSRKYEDLLWAWEGWRDKAGRAILQFYPKYVELINQAAR
LNGYVDAGDSWRSMYETPSLEQDLERLFQELQPLYLNLHAYVRRALHRHYGAQHINLEGP
IPAHLLGNMWAQTWSNIYDLVVPFPSAPSMDTTEAMLKQGWTPRRMFKEADDFFTSLGLL
PVPPEFWNKSMLEKPTDGREVVCHASAWDFYNGKDFRIKQCTTVNLEDLVVAHHEMGHIQ
YFMQYKDLPVALREGANPGFHEAIGDVLALSVSTPKHLHSLNLLSSEGGSDEHDINFLMK
MALDKIAFIPFSYLVDQWRWRVFDGSITKENYNQEWWSLRLKYQGLCPPVPRTQGDFDPG
AKFHIPSSVPYIRYFVSFIIQFQFHEALCQAAGHTGPLHKCDIYQSKEAGQRLATAMKLG
FSRPWPEAMQLITGQPNMSASAMLSYFKPLLDWLRTENELHGEKLGWPQYNWTPNSARSE
GPLPDSGRVSFLGLDLDAQQARVGQWLLLFLGIALLVATLGLSQRLFSIRHRSLHRHSHG
PQFDSEVELRHS
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atgggccagggttgggctactgcaggacttcccagcctcctcttcctgctgctctgctac
gggcaccctctgctggtccctagccaggaggcaccccgacaggtgacagtcacccatggg
acaagcagccaggcaacaaccagcggccagacaaccacccaccaggcgacggcccaccag
acatcagcccagagcccaaacctggtgactgatgaggctgaggccagcaagtttgtggag
gaatatgaccggacatcccaggtggtgtggaacgagtatgccgaggccaactggaactac
aacaccaacatcaccacagagaccagcaagattctgctgcagaagaacatgcagatagcc
aaccacaccctgaaatacggcacccaggccaggaggtttgatgtgaaccagttgcagaac
accactatcaagcggatcataaagaaggttcaggacctagaacgggcagcgctgcctgcc
caggagctggaggagtacaacaagatcctgttggatatggaaaccacctacagcgtggcc
actgtgtgccacacaaatggcagctgcctgcagctcgagccagatctgacgaatgtgatg
gccacatcccggaaatatgaagacttgttatgggcatgggagggctggcgagacaaggcg
gggagagccatcctccagttttacccgaaatacgtggaactcatcaaccaggctgcccgg
ctcaatggctatgtagacgcaggggactcgtggaggtctatgtacgagacaccatccctg
gagcaagacctggagcggctcttccaggagctgcagccgctctacctgaacctgcatgcc
tacgtgcgccgggccctgcaccgtcactatggggcccagcacatcaacctggaggggccc
attcctgctcacctgctggggaacatgtgggcgcagacctggtccaacatctatgacttg
gtggtgcccttcccttcagccccctcgatggacaccacagaggctatgctaaagcagggc
tggacacccaggaggatgtttaaggaggctgatgatttcttcacctccctggggctgctg
cccgtgcctcctgagttctggaacaagtcgatgctggagaagccaaccgacgggcgggag
gtggtctgccacgcctcggcctgggacttctacaacggcaaggacttccggatcaagcag
tgcaccaccgtgaacttggaggacctggtggtggcccaccacgaaatgggccacatccag
tatttcatgcagtacaaagacttacctgtggccttgagggagggtgccaaccccggcttc
catgaggccattggggacgtgctagccctctcagtgtctacgcccaagcacctgcacagt
ctcaacctgctgagcagtgagggtggcagcgacgagcatgacatcaactttctgatgaag
atggcccttgacaagatcgcctttatccccttcagctacctcgtcgatcagtggcgctgg
agggtatttgatggaagcatcaccaaggagaactataaccaggagtggtggagcctcagg
ctgaagtaccagggcctctgccccccagtgcccaggactcaaggtgactttgacccaggg
gccaagttccacattccttctagcgtgccttacatcaggtacttcgtcagcttcatcatc
cagttccagttccatgaggcactgtgccaggcagctggccacacgggccccctgcacaag
tgtgacatctaccagtccaaggaggccgggcagcgcctggcgaccgccatgaagctgggc
ttcagtaggccgtggccggaagccatgcagctgatcacgggccagcccaacatgagcgcc
tcggccatgttgagctacttcaagccgctgctggactggctccgcacggagaacgagctg
catggggagaagctgggctggccgcagtacaactggacgccgaactccgctcgctcagaa
gggcccctcccagacagcggccgcgtcagcttcctgggcctggacctggatgcgcagcag
gcccgcgtgggccagtggctgctgctcttcctgggcatcgccctgctggtagccaccctg
ggcctcagccagcggctcttcagcatccgccaccgcagcctccaccggcactcccacggg
ccccagttcgactccgaggtggagctgagacactcctga

DBGET integrated database retrieval system