KEGG   Pan paniscus (bonobo): 100993013Help
Entry
100993013         CDS       T02283                                 

Definition
(RefSeq) trypsin-1-like
  KO
K01312  
trypsin [EC:3.4.21.4]
Organism
pps  Pan paniscus (bonobo)
Pathway
Neuroactive ligand-receptor interaction
Pancreatic secretion
Protein digestion and absorption
Influenza A
Brite
KEGG Orthology (KO) [BR:pps00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100993013
 Organismal Systems
  Digestive system
   04972 Pancreatic secretion
    100993013
   04974 Protein digestion and absorption
    100993013
 Human Diseases
  Infectious diseases
   05164 Influenza A
    100993013
Enzymes [BR:pps01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     100993013
Peptidases [BR:pps01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   100993013
Exosome [BR:pps04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100993013
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
7
AA seq 247 aa AA seqDB search
MNPLLILAFVGAAVAAPFDDDDKIVGGYTCQKNSLPYQVSLNSGYHFCGGSLINEQWVVS
AAHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPQYNSKTVNNDIMLIKLSTPAVIN
ARVSTISLPTAPPAAGTECLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGKIT
SNMFCVGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGYGCAQKNRPGVYTKVYNYVKWIK
DTIAANS
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaatccactcctgatccttgcctttgtgggagctgctgttgctgccccctttgacgat
gatgacaagatcgttgggggctacacctgtcagaagaattctctcccctaccaggtgtcc
ctgaattctggctaccacttctgcggtggctccctcatcaacgaacagtgggtggtatca
gcagctcactgctacaagtcccgcatccaggtgagactgggagagcacaacatcgaagtc
ctggaggggaatgagcagttcataaatgcggccaagatcatccgccacccccaatacaac
agtaagactgtgaacaatgacatcatgctgatcaagctctccacacctgccgtcatcaat
gcccgtgtgtccaccatctctctgcccaccgcccctccagctgctggcaccgagtgcctc
atctccggctggggcaacactgcgagctctggcgccgactacccagacgagctgcagtgc
ctggacgctcctgtgctgagccaggctaagtgtgaagcctcctaccctggaaagattacc
agcaacatgttctgtgtgggcttcctcgagggaggcaaggattcctgccagggtgactct
ggtggtcctgtggtctgcaatggacagctccaaggagttgtctcttggggctatggttgt
gcccagaagaacaggcctggagtctacaccaaggtctacaactatgtgaaatggattaag
gacaccatagctgccaacagctaa

DBGET integrated database retrieval system