KEGG   Pseudomonas psychrophila: AOC04_01885Help
Entry
AOC04_01885       CDS       T04081                                 

Definition
(GenBank) glutathione S-transferase
  KO
K11209  GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
ppsy  Pseudomonas psychrophila
Brite
Enzymes [BR:ppsy01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     AOC04_01885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_C GST_N_3 GST_C_3 GST_N_2 GST_C_2
Motif
Other DBs
NCBI-ProteinID: ALE87050
UniProt: A0A0M5LV07
LinkDB All DBs
Position
complement(407707..408348)
Genome map
AA seq 213 aa AA seqDB search
MIDLYYWTTPNGHKISLFLEEAGLPYTVHPVNIGKNEQFEPAFLKISPNNRIPAIVDQAP
GDGGDPLSLFESGAILLYLAEKTGRFLPKDLRGRQMALQWLFWQMGGLGPMAGQNHHFNR
FAPEKVPYAIKRYTDETARLYGVLNKQLEGRQFVAGDDYSIADMAIYPWIVPHEFQGQNL
DDFPALKAWFQRIKARPATGRAYALVDKINPPK
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatctgtattactggaccacccccaacggccacaaaatatcgttgtttcttgaa
gaggcgggcctgccctacaccgtgcatccggtgaatatcggcaagaacgaacaattcgaa
cctgcctttctgaagatatcccccaacaatcggattccggccatcgtcgatcaggctccc
ggggacggcggcgatcccctgtcgctgtttgagtccggcgcgatcctgctgtatctcgca
gaaaaaaccggccggttcctgcccaaagatttgcgcggccggcaaatggctctgcaatgg
ctgttctggcaaatgggcgggctggggccaatggccgggcaaaaccatcacttcaatcgt
ttcgcgcccgaaaaagtcccctatgcgatcaagcgctacaccgatgaaacagcccgcctg
tatggcgtgttgaacaaacagctggagggtcgtcagtttgttgccggggacgactacagc
atcgccgacatggccatctatccgtggatcgtgccccatgaattccagggccagaacctg
gatgacttcccggcattgaaggcctggttccagcgtatcaaggcacgcccggccaccgga
cgcgcttatgcactggtggataagatcaatccaccgaagtaa

DBGET integrated database retrieval system