KEGG   Pseudomonas putida S16: PPS_0436Help
Entry
PPS_0436          CDS       T01570                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
ppt  Pseudomonas putida S16
Brite
Translation factors [BR:ppt03012]
 Eukaryotic Type
  Elongation factors
   PPS_0436
 Prokaryotic Type
   PPS_0436
Mitochondrial biogenesis [BR:ppt03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    PPS_0436
Exosome [BR:ppt04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PPS_0436
  Exosomal proteins of breast cancer cells
   PPS_0436
  Exosomal proteins of colorectal cancer cells
   PPS_0436
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
520595..521788
Genome map
AA seq 397 aa AA seqDB search
MAKEKFDRSLPHVNVGTIGHVDHGKTTLTAALTRVCSEVFGSAVVEFDKIDSAPEEKARG
ITINTAHVEYNSNIRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLSRQVGVPYIVVFLNKADLVDDAELLELVEMEVRDLLSTYDFPGDDTPIIIGSARMALE
GKDDNEMGTTAVKKLVETLDAYIPEPVRAVDQPFLMPIEDVFSISGRGTVVTGRIERGIV
RVQDPLEIVGLRDTTTTTCTGVEMFRKLLDEGRAGENCGVLLRGTKRDDVERGQVLVKPG
SVKPHTKFTAEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTGNCELPEGVEMVMPGDNI
QMTVTLIKTIAMEDGLRFAIREGGRTVGAGVVAKIIE
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggctaaggaaaagtttgatcgttcccttccccacgttaacgtcggcactatcggccac
gttgaccacggtaagaccactctgaccgcagctctgactcgcgtctgctccgaagttttc
ggttcggcagtcgttgagttcgacaagatcgactcggctccggaagaaaaagcgcgcggt
atcaccatcaacaccgctcacgtcgagtacaactcgaacattcgtcactacgctcacgtt
gactgcccaggtcacgctgactacgtgaagaacatgatcaccggtgctgcccagatggac
ggcgcgatcctggtttgctcggccgccgatggtccgatgccgcaaacccgtgagcacatc
ctgctgtcccgtcaggtaggcgttccttacatcgtggtcttcctgaacaaggctgacctg
gtagacgacgccgagctgctggaactggtcgagatggaagttcgcgacctgctgtccacc
tacgacttcccaggcgacgacaccccgatcatcatcggttcggctcgtatggccctggaa
ggcaaagacgacaacgaaatgggtactaccgctgtcaagaagctggtagaaactctggat
gcctacatccctgagccagttcgtgccgttgaccagccgttcctgatgccgatcgaagac
gtattctcgatctcgggtcgtggtaccgttgttaccggtcgtatcgagcgtggtatcgtc
cgcgttcaggatccgctggaaatcgttggtctgcgtgacaccaccaccaccacctgcacc
ggtgttgagatgttccgcaagttgctggacgaaggccgtgctggcgagaactgcggcgtt
ctgctgcgtggtaccaagcgtgatgacgttgagcgtggccaggttctggtcaagccaggt
tcggtcaagccgcacaccaagttcaccgcagaagtctacgttctgtcgaaggaagaaggc
ggtcgtcacactccgttcttcaaaggctaccgtcctcagttctacttccgtaccactgac
gtgaccggtaactgcgaactgccggaaggcgttgaaatggtaatgccaggtgacaacatt
cagatgactgtcaccctgatcaagaccatcgcaatggaagacggtctgcgcttcgctatc
cgtgaaggcggtcgtaccgtcggcgccggcgtcgtagcaaaaattattgaataa

DBGET integrated database retrieval system