KEGG   Pseudomonas putida S16: PPS_0448Help
Entry
PPS_0448          CDS       T01570                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
ppt  Pseudomonas putida S16
Brite
Translation factors [BR:ppt03012]
 Eukaryotic Type
  Elongation factors
   PPS_0448
 Prokaryotic Type
   PPS_0448
Mitochondrial biogenesis [BR:ppt03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    PPS_0448
Exosome [BR:ppt04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PPS_0448
  Exosomal proteins of breast cancer cells
   PPS_0448
  Exosomal proteins of colorectal cancer cells
   PPS_0448
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW
Motif
Other DBs
NCBI-ProteinID: AEJ11033
UniProt: F8G118
LinkDB All DBs
Position
537192..538385
Genome map
AA seq 397 aa AA seqDB search
MAKEKFDRSLPHVNVGTIGHVDHGKTTLTAALTRVCSEVFGSAVVEFDKIDSAPEEKARG
ITINTAHVEYNSNIRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLSRQVGVPYIVVFLNKADLVDDAELLELVEMEVRDLLSTYDFPGDDTPIIIGSARMALE
GKDDNEMGTTAVKKLVETLDAYIPEPVRAVDQPFLMPIEDVFSISGRGTVVTGRIERGIV
RVQDPLEIVGLRDTSTTTCTGVEMFRKLLDEGRAGENCGVLLRGTKRDDVERGQVLVKPG
SVKPHTKFTAEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTGNCELPEGVEMVMPGDNI
QMTVTLIKTIAMEDGLRFAIREGGRTVGAGVVAKIIE
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
gtggctaaagaaaaatttgatcgttcccttccccacgttaacgtcggcaccatcggccac
gttgaccacggtaagaccactctgaccgcagctctgactcgcgtctgctccgaagttttc
ggttcggcagtcgttgagttcgacaagatcgactcggctccggaagaaaaagcgcgcggt
atcaccatcaacaccgctcacgtcgagtacaactcgaacattcgtcactacgctcacgtt
gactgcccaggtcacgctgactacgtgaagaacatgatcaccggtgctgcccagatggac
ggcgcgatcctggtttgctcggccgccgatggtccgatgccgcaaacccgtgagcacatc
ctgctgtcccgtcaggtaggcgttccttacatcgtggtcttcctgaacaaggctgacctg
gtagacgacgccgagctgctggaactggtcgagatggaagttcgcgacctgctgtccacc
tacgacttcccaggcgacgacaccccgatcatcatcggttcggctcgtatggccctggaa
ggcaaagacgacaacgaaatgggtactaccgctgtcaagaagctggtagaaactctggat
gcctacatccctgagccagttcgtgccgttgaccagccgttcctgatgccgatcgaagac
gtattctcgatctcgggtcgtggtaccgttgttaccggtcgtatcgagcgtggtatcgtc
cgcgttcaggatccgctggaaatcgttggtctgcgtgacacttcgaccaccacctgcacc
ggtgttgaaatgttccgcaagctgctggacgaaggccgtgctggcgagaactgcggcgtt
ctgctgcgtggtaccaagcgtgatgacgttgagcgtggccaggttctggtcaagccaggt
tcggtcaagccgcacaccaagttcaccgcagaagtctacgttctgtcgaaggaagaaggc
ggtcgtcacactccgttcttcaaaggctaccgtcctcagttctacttccgtaccactgac
gtgaccggtaactgcgaactgccggaaggcgttgaaatggtaatgccaggtgacaacatt
cagatgactgtcaccctgatcaagaccatcgcaatggaagacggtctgcgcttcgctatc
cgtgaaggcggtcgtaccgtcggcgccggcgtcgtagcaaaaatcatcgagtaa

DBGET integrated database retrieval system