KEGG   Pseudomonas putida NBRC 14164: PP4_42060Help
Entry
PP4_42060         CDS       T02707                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ppun  Pseudomonas putida NBRC 14164
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:ppun00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PP4_42060 (ppc)
  Energy metabolism
   00680 Methane metabolism
    PP4_42060 (ppc)
Enzymes [BR:ppun01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     PP4_42060 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(4776975..4779602)
Genome map
AA seq 875 aa AA seqDB search
MTDIDVRLREDVHVLGELLGETIRQQHGDAFLQKIEDIRHSAKADRRGPGEQLTSTLADL
AEEDLLPVARAFNQFLNLANMAEQYQLIRRRDAGQAEPFEARVLPELLARLKQAGHSNDA
LARQLAKLDIQLVLTAHPTEVARRTLIQKYDAIAGQLAAQDHRDLTPDERHQVRERLRRL
IAEAWHTEEIRRTRPTPVDEAKWGFAVIEHSLWHAIPSHLRKVDKALLDATGLRLPLEAA
PIRFASWMGGDRDGNPNVTAAVTREVLLLARWMAADLFLRDIDALAAELSMQQASDALRE
RVGDSAEPYRAVLKQLRDRLRATRAWAHTALTSSQPASAEVLVDNRDLIAPLELCYQSLH
ECGMGVIAEGPLLDCLRRAVTFGLFLGRLDVRQDAARHRDALTEITDYLGLGRYADWDED
RRIEFLQAELKNRRPLLPAHFRPQADTAEVLATCREVAAAPAASLGSYVISMAGAASDVL
AVQLLLKEAGLTRPMRVVPLFETLADLDNAGPVMQRLLGLPGYRAGLRGPQEVMIGYSDS
AKDAGTTAAAWAQYRAQENLVRICAEHQVELLLFHGRGGTVGRGGGPAHAAILSQPPGSV
AGRFRTTEQGEMIRFKFGLPGIAEQNLNLYLAAVLEATLLPPPPPQPAWREVMDQLAADG
VKAYRSVVRDNPDFVEYFRQSTPEQELGRLPLGSRPAKRRAGGIESLRAIPWIFGWTQTR
LMLPAWLGWETALSNALARGQGELLAQMREQWPFFRTRIDMLEMVLAKADAQIAEAYDER
LVQPDLLPLGAHLRDLLSQSCQVVLGLTGQQVLLAHSPETLEFISLRNTYLDPLHRLQAE
LLARSRSREAALDSPLEQALLVTVAGIAAGLRNTG
NT seq 2628 nt NT seq  +upstreamnt  +downstreamnt
atgactgatatcgatgtgcgtttgcgtgaagatgtccatgtgttgggtgagctgctcggc
gaaaccattcgccagcagcatggcgatgcgttcttgcagaaaattgaagacatccgccac
agcgccaaggccgaccgccgcggccccggcgagcaattgacctcgaccctggccgacctt
gccgaagaagacttgctacccgtcgccagggccttcaaccagttcctcaacctggccaac
atggccgagcagtaccagttgatccgccgccgcgacgccggccaggccgaacccttcgag
gcccgtgtgctgcccgaattgctggcgcgcctgaagcaggccgggcatagcaacgatgcc
ctggcccggcaactggccaagctcgacatccaattggtgcttacggcgcaccccaccgag
gtggcccgtcgcaccttgatccagaagtacgacgccatcgccggccagctggctgcccag
gaccaccgtgacctgaccccggacgaacgccatcaggtgcgtgaacgcttgcgccggctg
attgccgaggcctggcacaccgaagaaatccgccgcacccggccgacgccggtagacgaa
gccaagtggggcttcgcggtgatcgagcattcgctgtggcacgccatccccagccacctg
cgcaaggtcgacaaggccctgctggatgccaccggcttgcgcctgccgctggaggccgcg
ccaattcgctttgcctcgtggatgggcggtgaccgtgacggcaaccccaatgtgactgcc
gccgttacccgggaagtgctgttgctggcgcgctggatggccgccgacctgttcctgcgc
gacatcgatgcactggccgccgagttgtccatgcagcaggccagtgacgcgttgcgcgaa
cgggtgggcgacagtgccgaaccctaccgcgccgtgctcaagcaactgcgcgaccgcctg
cgggcgacgcgtgcatgggcgcataccgctttgaccagcagccagccggccagcgccgag
gtgctggtggataaccgcgacctgattgcgccactggagctgtgctatcagtcgctgcac
gaatgcggcatgggcgttatcgccgaagggccgttgctcgattgcctgcgccgcgccgtc
actttcggccttttcctgggccgcctggacgtgcgccaggacgctgcccgccaccgtgac
gcgctgaccgaaatcaccgactacctgggcctgggccgctatgccgactgggatgaagat
cgccgcatcgaattccttcaggccgagctgaaaaaccgccgcccgctgttgcccgcacac
ttcaggccgcaggcagacaccgccgaggtgctggccacctgccgggaagtcgccgccgcg
cccgctgcctcgctgggctcctatgtcatttccatggccggtgccgcttcggatgtgctg
gcggtgcaactgttgctcaaggaagccggcctgacccgccccatgcgtgtggtaccgctg
ttcgagaccctggctgacctggacaacgccgggccggtgatgcagcgcctgctcggcctg
ccgggttaccgggccgggctgcgcggcccgcaggaagtgatgatcggctactccgactcg
gccaaggatgctggcaccacggcggcggcctgggcgcagtaccgggcccaggaaaacctg
gtgcgcatctgcgccgaacaccaggtcgaactgctgctgttccacggccggggcggtacg
gtagggcgcggcggtggcccggcccacgcagcgatcctgtcgcagccaccgggttcggtg
gcggggcggttccgcaccaccgagcagggcgaaatgatccgcttcaagttcggtttgccg
ggcatcgccgagcaaaacctgaacctgtacctggccgctgtgctcgaagccacgctgttg
cccccgccgcccccgcaaccggcctggcgcgaggtgatggaccagttggctgctgatggc
gtcaaggcgtaccgcagtgtggtgcgcgacaaccccgatttcgtcgagtacttccgccag
tcgacgccagaacaggaactggggcgcctgccgctgggcagccgccccgccaagcgccgg
gcaggcgggatcgaaagcctgcgggccatcccatggatcttcggctggacccagacccgg
ctgatgctgccggcctggctgggctgggaaaccgcgctgagcaatgccttggcccgtggc
caaggtgagttgctggcacagatgcgcgagcagtggccgtttttccgtacccgcatcgac
atgctggaaatggtgctggccaaggccgatgcgcaaatagccgaggcctacgacgaacgt
ctggtgcaaccggacttgcttcctttaggtgcacacctgcgcgacctattgtcgcagtct
tgccaggtggtactggggctgaccgggcagcaggtgctactggcgcacagccccgagacg
ctggaattcatcagcctgcgcaacacctacctggacccgctgcaccgcctgcaggccgag
ttgctggcccgctcgcgcagccgcgaagccgctctggacagcccgttggagcaggccttg
ctggtgaccgtggcgggtattgccgccgggctgcgcaataccggctga

DBGET integrated database retrieval system