KEGG   Pseudomonas sp. UW4: PputUW4_04501Help
Entry
PputUW4_04501     CDS       T02357                                 

Gene name
ddl
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  
D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ppuu  Pseudomonas sp. UW4
Pathway
D-Alanine metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ppuu00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    PputUW4_04501 (ddl)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PputUW4_04501 (ddl)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    PputUW4_04501 (ddl)
Enzymes [BR:ppuu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     PputUW4_04501 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:ppuu01011]
 Precursor biosynthesis
  Amino acid ligase
   PputUW4_04501 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(5167872..5168855)
Genome map
AA seq 327 aa AA seqDB search
MTAAYANLFSTIAPKDFGRVAVLFGGKSAEREVSLKSGNAVLDALLSAGVDAFGLDVGDD
LLQRLQSEKIDRAFIILHGRGGEDGSMQGLLECLGIPYTGSGILASALAMDKLRTKQVWH
SLGIPTPRHAVLCSEADCISAATELGFPLIVKPAHEGSSIGMAKVSSASELIDAWKAAST
YDSQVLVEQWIHGPEFTIATLRDQVLPPIALGTTHSFYDYDAKYIANDTQYRIPCGLDRV
KEQELMELTAKACEALGIAGWGRADVMQDAEGQFWFLEVNTAPGMTDHSLVPMAARAAGL
DFQQLVLAILAESVAGNAAGYQESTRG
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgactgctgcctacgccaacctgttctccacgatcgcgccgaaagacttcggccgcgtc
gccgtgctgttcggcggcaagagtgccgagcgcgaggtgtccctgaagtcgggcaacgcg
gttctcgacgcgctgctaagcgccggtgtcgacgcgttcggcctcgacgtgggcgatgac
ctgctgcagcgtctgcagagcgaaaagatcgaccgcgccttcatcatcctccacggtcgt
ggcggtgaagacggcagcatgcagggcctgctcgaatgcctgggcattccgtacaccggc
agcggcatcctggcgtcggccctggcgatggacaaactgcgcaccaagcaggtctggcac
agcctgggcattccgacgccacgtcacgcagtcctttgcagcgaggccgattgtatttcg
gcagcgacggaactgggcttccctttgatcgtcaaaccggcccatgaaggttcaagtatc
ggtatggccaaagtgagttccgcgtccgaattgatcgacgcatggaaagcggccagtacc
tacgattcgcaagtgttggtcgagcaatggattcacggtccggagttcaccatcgccact
ctgcgtgaccaggtgttgcctccgattgccctgggcacgacgcacagcttctacgactac
gacgccaagtacatcgccaacgatacccagtaccgcattccatgtggtctggaccgcgtc
aaggaacaggaactcatggaactcacggcgaaagcctgtgaagcgctgggtatcgccggt
tggggcagggcagacgtgatgcaggacgccgaagggcagttctggttcctggaagtcaac
accgcaccgggcatgaccgatcacagcctggtgccgatggcggcccgtgccgccggtctg
gatttccagcaactggtcctggccattctggccgagagcgttgccggcaatgctgccggt
taccaagagtcgacgagaggttaa

DBGET integrated database retrieval system