KEGG   Pseudomonas putida W619: PputW619_4751Help
Entry
PputW619_4751     CDS       T00675                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
ppw  Pseudomonas putida W619
Brite
Translation factors [BR:ppw03012]
 Eukaryotic Type
  Elongation factors
   PputW619_4751
 Prokaryotic Type
   PputW619_4751
Mitochondrial biogenesis [BR:ppw03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    PputW619_4751
Exosome [BR:ppw04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PputW619_4751
  Exosomal proteins of breast cancer cells
   PputW619_4751
  Exosomal proteins of colorectal cancer cells
   PputW619_4751
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
complement(5230534..5231727)
Genome map
AA seq 397 aa AA seqDB search
MAKEKFDRSLPHVNVGTIGHVDHGKTTLTAALTRVCSEVFGSAIVEFDKIDSAPEEKARG
ITINTAHVEYNSTIRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLSRQVGVPYIVVFLNKADLVDDAELLELVEMEVRDLLSTYDFPGDDTPIIIGSARMALE
GKDDNEMGTTAVKKLVETLDSYIPEPVRAIDQPFLMPIEDVFSISGRGTVVTGRIERGIV
RVQDPLEIVGLRDTTTTTCTGVEMFRKLLDEGRAGENCGVLLRGTKRDDVERGQVLVKPG
SVKPHTKFTAEVYVLSKEEGGRHTPFFKGYRPQFYFRTTDVTGNCELPEGVEMVMPGDNI
QMTVTLIKTIAMEDGLRFAIREGGRTVGAGVVAKIIE
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
gtggctaaagaaaaatttgatcgttcccttccgcacgttaacgttggcaccatcggccac
gttgaccacggtaagaccactctgaccgcagctctgactcgcgtttgctccgaagttttc
ggctcggcaatcgttgagttcgacaagatcgactcggctccggaagaaaaagcgcgcggt
atcaccatcaacaccgctcacgttgagtacaactcgaccattcgtcactacgctcacgtt
gactgcccaggtcacgctgactacgtgaagaacatgatcaccggtgctgcccagatggac
ggcgcgatcctggtttgctcggccgccgatggtccgatgccacaaacccgtgagcacatc
ctgctgtcccgtcaggttggcgttccgtacatcgtggtcttcctgaacaaggctgacctg
gtagacgacgctgagctgctggaactggtcgagatggaagttcgcgacctgctgtccacc
tacgacttcccaggcgacgacactccgatcatcatcggttccgctcgtatggccctggaa
ggcaaagacgacaacgaaatgggcactaccgctgtcaagaagctggtagaaactctggac
agctacattcctgagccagttcgtgccatcgaccagccgttcctgatgccgatcgaagac
gtattctcgatctcgggtcgtggtaccgttgttaccggtcgtatcgagcgtggtatcgtc
cgcgttcaggatccgctggaaatcgttggtctgcgtgacaccaccaccaccacctgcacc
ggtgttgagatgttccgcaagctgctggacgaaggtcgtgctggcgagaactgcggcgtt
ctgctgcgtggtaccaagcgtgacgacgttgagcgtggccaggttctggtcaagccaggt
tcggtcaagccgcacaccaagttcaccgcagaagtctacgttctgtcgaaggaagaaggc
ggccgtcacactccgttcttcaaaggctaccgtcctcagttctacttccgtaccactgac
gtgaccggtaactgcgaactgccggaaggcgttgaaatggtaatgccaggtgacaacatt
cagatgactgttaccctgatcaagaccatcgcaatggaagacggtctgcgcttcgctatc
cgtgaaggcggtcgtaccgtcggcgccggcgtcgtagccaaaatcatcgagtaa

DBGET integrated database retrieval system