KEGG   Paenibacillus polymyxa E681: PPE_00708Help
Entry
PPE_00708         CDS       T01319                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ppy  Paenibacillus polymyxa E681
Brite
Enzymes [BR:ppy01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     PPE_00708
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N DUF2935
Motif
Other DBs
NCBI-ProteinID: ADM68562
UniProt: E0RGU7
LinkDB All DBs
Position
complement(772235..773614)
Genome map
AA seq 459 aa AA seqDB search
MLSTYGSFLPLRVLEEIRHWKQQESWHVEVIKSATEGLEPTYVRLLDDWRTVFEQTERTA
IELLEEQRSALDPADQAWHQEWKQMSAAPQAHTHEFTEHSKQSRGLDATSSVKIPLTESA
LNYQPDSQELNRRLDDLLQTANRQSQEYVRQLGLLSEHSLALRQQPKSAGVVLHAAHESQ
YFLISTTPFQEPGSIARAARLYHVAAEGENYPEEAFRERQAGIRGEGASTTKGVKSSQAQ
PSATEKTSIGRPVPIGGHRLPPLPYPYNALEPYIDEQTMRIHHDKHHLSYVNDLNKAEKK
LEEARKTGDFDLVKHWERELAFNGAGHYLHTLFWTIMSPQGGGNPSGPLAEQIKKDFGSY
DAFKKQFSSAAEKVEGGGWAILVWSPRAGRLEILQAEKHQNLTQWESIPLLAIDVWEHAY
YLKHQNERNKYIEDWWHVVNWPEVAERYTQASKLRWQPF
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgctgagtacttatgggtctttcctgcccttacgtgtgctggaggaaattcggcattgg
aagcagcaggaaagttggcatgtggaagtaattaaatccgctaccgagggactggagcct
acttatgtacggctgctggatgattggcggactgtattcgaacagacggaacgcaccgcc
atagagttgctagaagagcaacggagcgcactcgatccagcagatcaggcgtggcatcag
gaatggaaacagatgtcggctgctccacaagcacatacacacgaattcactgaacattca
aaacagtcaaggggattagacgcaacatcatctgtaaagataccattgacagagtcagcc
ttaaactatcagcctgactcacaagaactaaatcgtcgactggacgatttgctgcaaacc
gcaaaccgtcagtcacaggagtatgtacgacagctcggcctgctaagcgagcacagtctt
gcattgcgtcagcagccaaaatccgccggagttgtattacacgcggcacatgaaagccaa
tatttcctgatctcgacaaccccttttcaagaacccggctccatcgcaagggccgctaga
ttgtatcatgtggcggcagagggcgagaattacccagaggaagcgtttcgagaacggcag
gcaggcatacggggagaaggcgcatcgacgactaaaggcgtcaagtccagccaggcgcaa
ccttcagcaacggaaaaaacctcaatcggccggccagttcctattggtggacatcggtta
ccgccgcttccttacccctataatgcacttgaaccgtacattgatgaacaaacgatgcgt
attcaccatgacaagcatcatttaagctatgtgaatgacctgaataaagcggaaaagaag
ctggaggaagcccgaaaaacaggtgattttgacctcgtaaaacattgggaacgggaacta
gcattcaacggcgcaggccattacctgcatactcttttttggacgatcatgagtcctcaa
ggcggtggaaacccaagcggaccgctggctgaacagattaaaaaggattttggcagctac
gatgcattcaaaaaacaatttagttcggcagccgaaaaggtcgagggtggcggctgggcg
atcctggtgtggagtccgcgcgcgggacggcttgaaattttgcaggccgaaaagcaccag
aatctgactcaatgggagtccattccgctgctggcgatagatgtatgggaacatgcatat
tacttaaagcatcaaaacgagcgcaacaaatacattgaagattggtggcatgtcgttaac
tggccagaggttgcagagcgctatacccaagcgtccaagctgagatggcaacccttctaa

DBGET integrated database retrieval system