Podarcis raffonei (Aeolian wall lizard): 128417124 Help Entry 128417124         CDS       T09310                                  Symbol HRAS Name (RefSeq) GTPase HRas   KO K02833   GTPase HRas Organism praf  Podarcis raffonei (Aeolian wall lizard) Pathway praf04010   MAPK signaling pathway praf04012   ErbB signaling pathway praf04068   FoxO signaling pathway praf04137   Mitophagy - animal praf04140   Autophagy - animal praf04144   Endocytosis praf04150   mTOR signaling pathway praf04210   Apoptosis praf04218   Cellular senescence praf04370   VEGF signaling pathway praf04371   Apelin signaling pathway praf04510   Focal adhesion praf04540   Gap junction praf04625   C-type lectin receptor signaling pathway praf04810   Regulation of actin cytoskeleton praf04910   Insulin signaling pathway praf04912   GnRH signaling pathway praf04916   Melanogenesis praf05132   Salmonella infection Brite KEGG Orthology (KO) [BR:praf00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     128417124 (HRAS)    04012 ErbB signaling pathway     128417124 (HRAS)    04370 VEGF signaling pathway     128417124 (HRAS)    04371 Apelin signaling pathway     128417124 (HRAS)    04068 FoxO signaling pathway     128417124 (HRAS)    04150 mTOR signaling pathway     128417124 (HRAS)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     128417124 (HRAS)    04140 Autophagy - animal     128417124 (HRAS)    04137 Mitophagy - animal     128417124 (HRAS)   09143 Cell growth and death    04210 Apoptosis     128417124 (HRAS)    04218 Cellular senescence     128417124 (HRAS)   09144 Cellular community - eukaryotes    04510 Focal adhesion     128417124 (HRAS)    04540 Gap junction     128417124 (HRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     128417124 (HRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     128417124 (HRAS)   09152 Endocrine system    04910 Insulin signaling pathway     128417124 (HRAS)    04912 GnRH signaling pathway     128417124 (HRAS)    04916 Melanogenesis     128417124 (HRAS)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     128417124 (HRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:praf04131]     128417124 (HRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:praf04147]     128417124 (HRAS)    04031 GTP-binding proteins [BR:praf04031]     128417124 (HRAS) Membrane trafficking [BR:praf04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     128417124 (HRAS)  Endocytosis   Macropinocytosis    Ras GTPases     128417124 (HRAS) Exosome [BR:praf04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    128417124 (HRAS)   Exosomal proteins of colorectal cancer cells    128417124 (HRAS) GTP-binding proteins [BR:praf04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     128417124 (HRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 G-alpha Septin Ldh_1_N AAA_16 CbiA Motif Other DBs NCBI-GeneID:  128417124 NCBI-ProteinID:  XP_053251372 LinkDB All DBs Position 1:77528867..77593267 Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PARTVETRQAQELARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPG CMNCKCVIS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgaccgagtacaagctggtggtagttggggcaggaggcgtagggaaaagtgctttgacc attcagcttatccagaaccattttgttgatgagtatgatcccacgatagaggattcctac agaaagcaagtcgtcattgatggagagacctgtttgttagacatcttggacacagcaggc caagaagagtacagtgccatgcgagaccagtacatgcggacaggagaaggcttcctttgt gtctttgctattaacaacaccaagtcctttgaagacattcatcagtacagggagcagatc aagagggtgaaggactctgatgatgtcccgatggtattggtgggaaataagtgtgacctt ccagcccggactgtggaaacccggcaagcccaggagctggctcggagctatgggattccc tacatagagacatcagccaagactagacagggagttgaagatgccttctatactttagtg cgggagatccggcagcacaaactacgcaaattgaatcccccagatgaaagtggcccaggc tgcatgaattgtaaatgtgtgatatcatga

DBGET integrated database retrieval system